KEGG   Streptomyces avermitilis: SAVERM_1801
Entry
SAVERM_1801       CDS       T00126                                 

Gene name
bglC1
Definition
(GenBank) putative beta-glucosidase
  KO
K05350  beta-glucosidase [EC:3.2.1.21]
Organism
sma  Streptomyces avermitilis
Pathway
sma00460  Cyanoamino acid metabolism
sma00500  Starch and sucrose metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SAVERM_1801 (bglC1)
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    SAVERM_1801 (bglC1)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     SAVERM_1801 (bglC1)
SSDB
Motif
Pfam: Glyco_hydro_1 Cellulase
Other DBs
NCBI-ProteinID: BAC69512
NITE: SAV1801
UniProt: Q82M59
Position
complement(2200016..2201374)
AA seq 452 aa
MTIDLAALPHDFLWGTATAAYQIEGAVAEDGRSPSIWDTFSHTPGKIDNNDHGDVACDHY
HRWREDIGLMKQLGTNAYRLSVAWPRVIPGGDGPVNAKGLAFYDELVDGLLEAGITPSVT
LYHWDLPQVLQDRGGWPERATAEHFAAYAAVVAERLGDRVTHWATLNEPLCSAWIGHLEG
KMAPGLTDLTAAIRASYHLLLGHGLAAQAIRAAAPAAEVGIVNNLSTIHAASDRPEDVAA
ARRMDGHVNRWWLDPVHGRGFPADMREVYGVELPEQPGDLATIAAPLDWLGLNYYFPATV
ADDPTGPAPRVRSVRRLGVPRTGMDWEIDATGIETLLLRLTHEYGPRKLYVTENGSAFPD
VVRPDGTVDDPERQDYLVRHLAACASAARKGAPLAGYFAWSLLDNFEWAYGYDKRFGLVH
VDYRTQVRTIKGTGHRYADIVRTHRGRARRAA
NT seq 1359 nt   +upstreamnt  +downstreamnt
gtgaccatcgacctcgccgcactcccgcacgacttcctgtggggtacggccacagcggcg
taccagatcgagggagccgtcgccgaggacggccgctcgccgtcgatctgggacaccttc
tcgcacacccccggcaagatcgacaacaacgaccacggcgacgtcgcctgcgaccactac
caccgctggcgcgaggacatcgggctgatgaagcaactcggcaccaacgcctaccggctc
tccgtcgcctggccgcgggtgatcccgggcggcgacgggccggtgaacgccaagggcctc
gccttctacgacgagttggtcgacggtctgctggaagcgggcatcaccccgtccgtcacc
ctctaccactgggacctgccccaggtcctccaggaccgcggcggctggcccgaacgggcg
accgccgagcacttcgccgcgtacgcagcggtcgtcgccgaacgcctgggcgaccgcgtc
acccactgggccaccctcaacgaacctctctgctccgcctggatcggccacctcgaaggc
aagatggcccccggcctcaccgacctgaccgccgcgatccgggcctcgtaccacctgctc
ctcgggcacggcctggccgcccaggcgatccgcgccgcggccccggccgccgaggtcggc
atcgtcaacaacctctccaccatccatgccgccagcgaccgccccgaggacgtcgcggcg
gcgcgccgcatggacggccacgtcaaccgctggtggctggacccggtccacggccgcggc
ttcccggccgacatgcgcgaggtgtacggcgtcgaactgcccgagcagccgggagacctg
gcgacgatcgccgcgccgctcgactggctgggcctgaactactacttcccggccaccgtc
gccgacgaccccaccggaccggctccgcgtgtccgctcggtccgccggctcggcgtcccg
cgcaccggcatggactgggagatcgacgccaccggcatcgagaccctgctgctgcgcctc
acccacgagtacgggccccgcaagctgtacgtcaccgagaacggctccgccttccccgac
gtggtacgccccgacggcaccgtcgacgaccccgaacgccaggactacctcgtacgccac
ctggccgcgtgcgcctccgcggcccgcaagggcgcgccgctggccggctacttcgcgtgg
tcgctgctcgacaacttcgagtgggcgtacggctacgacaagcgcttcggcctggtccac
gtcgactaccgcacccaggtccggacgatcaagggaaccggccatcgctacgcggacatc
gtccgcacccaccggggccgggcgcgccgggccgcctga

KEGG   Streptomyces avermitilis: SAVERM_2578
Entry
SAVERM_2578       CDS       T00126                                 

Definition
(GenBank) putative sugar hydrolase
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
sma  Streptomyces avermitilis
Pathway
sma00460  Cyanoamino acid metabolism
sma00500  Starch and sucrose metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SAVERM_2578
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    SAVERM_2578
Enzymes [BR:sma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     SAVERM_2578
SSDB
Motif
Pfam: Glyco_hydro_3_C Glyco_hydro_3 Fn3-like CBM_6 Fascin
Other DBs
NCBI-ProteinID: BAC70289
NITE: SAV2578
UniProt: Q82K26
Position
3166246..3169110
AA seq 954 aa
MTAQTPPTPSFRDPRLPFAKRVDDLLARLTLDERIAFLHQFTPAVERLGIAAFRTGQEAL
HGVAWMGPATVFPQAVGLGATWNDDLVRRIGEAVSAETRAMRARDDRVGLNVWSPTVNLL
RHPLWGRGEEGYSEDPRLTSAIATAYTRGLRGDHPTYWRTAPVLKHWLAHNNETNRDTTS
SSVRPRVLHEYDLRAFRETVEAGAVAGVMPAYNLVNGRPNHVSPYLREHLRTWTDQELLV
CSDAGAPSNLVDSEHYFDTHEEATAAAVLAGVDSFTDHGTDSSKIVERVRGALVQGLLSE
ADIDEAVRRQLAIRFRLGEFDPRLDPYAGTLDFDTAAHRALARESAEQAVVLLKNEGLLP
LGPEVRIAAVGLLADECKLDWYSGTLLHRSTPLEGLYERFGADRVNFAEGVDRVRLRTSS
GAFLRVPVAENAAEVTADEARGAEGALDPALLAGRTDLPPLTTDAVGSELALIDWGEGVL
TLRAPDGRYLSVADDGYVRASADQPGGWVVQETFRLEPSESHDNGHLLKHTGTGRYVCVA
ADGVKVAAQEPRDAEIFELESTERGEDAVTRVAAAADVVLVFAGNDPHINGRETEDRTTL
RLPAHQERLLRAARAANPATALVLVSAYPYAVDHADLPAALWTAHGGQAAGTALARVLSG
DVSPAGRLPQTWYADDADLPGLLDYDVIGSRQTYLYFEGTPLFPFGHGLSYASFAYEGLE
HRTDEDTVRVSFTVTNTGSRAADEVAQLYIRAVDPSVPRPRRELAAHRRLRLAPGASAEL
AFALPSAAFAFWDVAHGRRRVEPGSYELLVGASSEDIRLRTTIELTGEAAAPRAVRALGL
KAADFDDQRNTEIVDRTKVSGDAVTPLDGGTGELVFRACDFGAGVSGVSADLAGEGVVEI
SLAGGPPPAVLTLPPTKGPYDYTTVTAAFAADGVHDVHLRLRGPLRLAQVGFSG
NT seq 2865 nt   +upstreamnt  +downstreamnt
gtgaccgcacaaacgccgcctacgccgtctttccgtgatccgcggctgccgttcgcgaag
cgcgtcgacgacctgctggcgcggctcacgctcgatgaacgcatcgcgttcctgcaccag
ttcacgcccgccgtcgagcgcctcggcatcgccgcgttccgcaccggccaggaagcgctg
cacggggtggcctggatgggcccggcgacggtgttcccgcaggccgtgggcctcggcgcg
acctggaacgacgacctggtacggcggatcggcgaggcggtctcggccgagacccgtgcg
atgcgcgcccgcgacgaccgggtcggcctcaacgtctggtcccccacggtcaatctgctg
cgccacccgctgtggggccggggcgaggagggctactcggaggacccgaggctgacctcg
gcgatcgcgacggcgtacacccgggggctgcgcggcgaccaccccacctactggcgcacg
gcgcccgtcctcaagcactggctggcccacaacaacgagacgaaccgcgacaccacgtcg
tcctcggtccgcccgcgcgtcctgcacgagtacgacctgcgcgccttccgcgagacggtc
gaggcgggcgcggtggccggtgtgatgcccgcgtacaacctggtcaacggccgccccaac
cacgtctcgccctatctgcgcgagcacctgcgcacctggacggaccaggaactgctggtc
tgctcggacgcgggtgcgccctccaacctggtcgactccgagcactacttcgacacccac
gaggaggcgacggcggcggcggtcctggccggcgtcgacagcttcaccgaccacggcacg
gacagctccaagatcgtcgagcgggtccgcggcgccctggtccagggcctgttgagcgag
gccgacatcgacgaggcggtccgccgccagctcgcgatccgtttccggctcggcgagttc
gacccgcgcctcgacccgtacgccggcaccttggacttcgacaccgcggcccatcgcgcg
ctcgcccgggagtccgcggagcaggcggtcgtcctgctcaagaacgagggactgctgccg
ctgggccccgaggtgcgcatcgcggccgtgggcctcctcgccgacgagtgcaagctcgac
tggtacagcggcaccctgctgcaccgctccaccccgctggagggcctgtacgaacgcttc
ggcgccgaccgcgtcaacttcgcggagggcgtggaccgcgtacgtctgaggacgtcgtcg
ggcgcctttctgcgggtgcccgtggccgagaacgcggccgaggtcacggccgacgaggcg
cgcggcgccgagggcgcgctggacccggcactgctcgcgggccgcaccgacctgcctccg
ctcacgaccgacgccgtcggcagcgaactcgcgctgatcgactggggcgagggcgtgctg
acgctgcgcgcgcccgacggccgttacctctcggtcgccgacgacgggtacgtacgcgcc
tccgcggaccagccgggcggctgggtcgtccaggagacgttccgcctcgaaccttccgaa
tcccatgacaacggccacctcctgaagcacacagggacgggcaggtacgtctgtgtcgcc
gccgacggcgtgaaggttgccgctcaggagccgcgggacgcggagatcttcgaactggag
tcgaccgagcgcggcgaggacgcggtgacgcgcgtcgccgccgcggcggacgtggtcctg
gtgttcgcgggcaacgatccgcacatcaacggccgggagaccgaggaccgtacgacgctg
cggctgcccgcccaccaggagcggctgctgcgcgccgcccgcgccgcgaacccggccacc
gccctggtcctggtctcggcgtacccgtacgcggtggaccacgccgacctcccggccgcc
ctgtggaccgcgcacggcggccaggccgcgggcaccgcgctggcccgcgtcctgtccggc
gacgtctcccccgcgggccggctcccgcagacctggtacgcggacgacgcggacctgccc
ggcctcctcgactacgacgtgatcggcagccgccagacgtatctgtacttcgagggcacg
cccctgttcccgttcggccacggcctgtcgtacgcgtcgttcgcgtacgaggggctcgaa
caccgcacggacgaagacacggtgcgggtctccttcaccgtcaccaacacgggctcccgg
gcggcggacgaggtggcccagctctacatccgggcggtggacccgtccgtcccgcgcccg
cgccgcgaactggccgcccaccgccgcctgcgcctcgcccccggcgcctcggcggagctg
gccttcgcactcccgtcggccgccttcgcgttctgggacgtggcgcacggccgccgacgg
gtggagccggggtcgtacgaactcctggtcggcgcgtcgagcgaggacatccggctgcgt
acgacgatcgagctgaccggcgaggcggcggccccccgcgccgtacgtgcgctcggcctg
aaggcggccgacttcgacgaccagcggaacaccgagatcgtcgaccgtacgaaggtgtcg
ggcgacgcggtgacaccgctggacggcgggacgggcgaactcgtcttccgcgcctgcgac
ttcggggccggtgtctcgggcgtcagcgcggatctcgcgggcgagggcgtcgtcgagatc
tccctggccggcggcccgccaccggcggtgctgaccctgcccccgacgaaggggccgtac
gactacaccaccgtgacggccgccttcgccgcggacggcgtgcacgacgtccacctcagg
ctgcgcggcccgctgcggctggcgcaggtcggcttctccggttga

KEGG   Streptomyces avermitilis: SAVERM_2708
Entry
SAVERM_2708       CDS       T00126                                 

Definition
(GenBank) putative glycosyl hydrolase, secreted
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
sma  Streptomyces avermitilis
Pathway
sma00460  Cyanoamino acid metabolism
sma00500  Starch and sucrose metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SAVERM_2708
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    SAVERM_2708
Enzymes [BR:sma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     SAVERM_2708
SSDB
Motif
Pfam: Glyco_hydro_3 CBM_11 Glyco_hydro_3_C Calx-beta CIA30
Other DBs
NCBI-ProteinID: BAC70419
NITE: SAV2708
UniProt: Q82JP6
Position
complement(3318766..3321801)
AA seq 1011 aa
MRRTALLVSAAMLTGLLPLAGAAAAVGADDPAPVPVDQFEGEVPFASPPAEGIFTWGGDT
DDPPQLALTARADAPEGDKVLTGTYDISGYGGFTHDFAFDRPAHDWSAHQGIRFWWDGRG
NGKKVAFEIKDGGANGEASELWTTSFTDDFTGWKQIEIPFTDFTYRTDYQPVGGIDQVLG
LTGMWGYAVTLPAGVKGQFAMDGVELYGRGDQSLRASVVTDSAVHPVKEGRTADVRVSVA
TTGSAPIDEPVTVAYEATGGTAESGKDYTPVKGSVTFPAGTASGTSRTIQVPTLKDRSAE
PAETIPLKLTVTGAKAPAETPQVVIDAHGLPYLDPKLPVKKRVADLVSRMSLEEKAGQMT
QAERGALTAQGDIAAYDLGSLLSGGGSTPTPNTPEAWAKMIDAFQLRAQATRFQIPLIYG
VDAVHGHNNLTGATIMPHNIGIGASRDPGIARRTGAVTAAEVRATGIPWDFAPCLCVTRD
ERWGRSYESFGEDPALVKSMETVIQGLQGARDGKDLKDDDKVLATAKHFVGDGGTAYGSS
TTGTYTIDQGVTKVTRQELEAVQLAPYQTAVDRGIGSVMPSYSSLDILGDGQGAVKMHAR
ADMINGVLKDRMGFDGFVISDWKAIDQIPGDYASDVRTSINAGLDMIMVPYEYKDFRTTL
IDEVKAGRVSQKRVDDAVSRILTQKFKLGLFEKPYADTSGASRIGSSAHRAVAREAAAES
QVLLKNAGGVLPLKKSQKVYVAGSNADDLGNQTGGWTITWQGSSGKHTDGTTILDGMRKA
AGSGGAVTYSKDASAPTSGYDVGVVVVGETPYAEGVGDVGNGNDLELTAADKAAVDKVCG
AMKCAVLIVSGRPQLIGDRLGDIDALVASWLPGTEGDGVADVLYGKRAFTGQLPVTWPKS
EAQLPINVGDTTYDPQFPYGWGLTTLTKVPAGGAATLKALAVAAAVAERTGSGKAGRALV
GKARLLVQQKAGSGPGITAAVAGPFADADHLLLTGKYGAAVAKLTEAYRAA
NT seq 3036 nt   +upstreamnt  +downstreamnt
atgcgaagaaccgccctgctcgtctcggccgccatgctcaccgggctgctgccccttgcc
ggagccgcggccgccgtcggcgcggacgacccggcgcccgtccccgtcgaccagttcgag
ggcgaagtccccttcgccagtccgcccgccgagggcatcttcacctggggcggcgacacc
gacgacccgccccagctcgccctgaccgcccgcgccgacgcgcccgagggcgacaaagtc
ctcaccggcacgtacgacatcagcggctacggcggcttcacccacgacttcgccttcgac
cggcccgcccacgactggtccgcgcaccagggcatccgcttctggtgggacggccggggc
aacggcaagaaggtcgccttcgagatcaaggacggcggcgccaacggcgaggcctccgag
ctgtggacgacgtccttcaccgacgacttcaccggctggaagcagatcgagatcccgttc
accgacttcacttaccgtacggactaccagcccgtcggcggcatcgaccaggtcctcggc
ctcaccgggatgtgggggtacgccgtcacgcttccggccggcgtcaagggccagttcgcc
atggacggcgtcgagttgtacggcaggggcgatcagtcgctgcgggcctccgtggtcacc
gactccgccgttcacccggtgaaggagggccgcacggccgacgtgcgggtctccgtcgcc
accaccggttccgccccgatcgacgagccggtgaccgtcgcgtacgaggcgacgggcggt
accgcggaatccggcaaggactacaccccggtcaagggctcggtcaccttcccggcgggc
acggcgtccggcacctcgcgcacgatccaggtgcccacgctcaaggacaggtccgcagaa
cccgccgagacgatccccctgaagctcacggtcaccggcgcgaaggcccccgccgagacc
ccgcaggtcgtcatcgacgcgcacgggctgccgtatctggacccgaagctgccggtgaag
aagcgggtcgccgacctcgtctcgcgcatgtccctggaggagaaggccgggcagatgacc
caggccgaacgcggcgcgctcaccgcgcagggcgacatcgcggcgtacgacctcggctca
ctcctgtccggcggcggctcgaccccgacgcccaacacccccgaggcgtgggcgaagatg
atcgacgccttccagctccgggcgcaggcgacacggttccagatcccgctgatctacggc
gtggacgccgtgcacggccacaacaacctcaccggcgcgacgatcatgccgcacaacatc
ggcatcggggcgtccagggatcctgggatcgcccggcggaccggcgcggtgaccgccgcc
gaggtccgcgccaccggcatcccatgggacttcgccccttgcctgtgcgtgacgcgcgac
gagcgctggggccgctcgtacgagtccttcggcgaggacccggccctcgtcaagtccatg
gagacggtcatccagggcctccagggtgcccgtgacggcaaggacctgaaggacgacgac
aaggtgctggccaccgccaagcacttcgtcggcgacggcggcaccgcgtacggctcgtcc
acgacgggcacgtacaccatcgaccagggcgtcaccaaggtcacccggcaggagctggag
gcggtgcagctcgcgccgtaccagaccgccgtggaccgcggtatcggctcggtcatgccc
tcgtactcgtcgctcgacatcctcggcgacggccagggcgcggtgaagatgcacgcccgc
gcggacatgatcaacggggtgctgaaggaccgcatgggcttcgacggcttcgtcatcagc
gactggaaggccatcgaccagatccccggcgactacgcgtccgacgtccgtacgtccatc
aacgcgggcctcgacatgatcatggtcccgtacgagtacaaggacttccgtacgacgctg
atcgacgaggtgaaggccggccgcgtcagtcagaagcgggtggacgacgccgtatcccgc
atcctcacccagaagttcaagctcggcctcttcgagaagccgtacgcggacacgagcggc
gcgtcgcggatcggctcgtccgcgcaccgcgccgtggcccgtgaggcggccgccgagtcg
caggtgctgctgaagaacgcgggcggggtgctgccgctgaagaagtcgcagaaggtctac
gtcgccggttcgaacgccgacgacctcggcaaccagaccggcggctggacgatcacctgg
cagggctcctcagggaagcacaccgacggcacgacgatcctggacggaatgcgcaaggcc
gcgggttccgggggcgccgtcacctactcgaaggacgcgtcggcgcccaccagcggctac
gacgtcggcgtggtcgtcgtcggcgagaccccgtacgccgagggcgtcggcgacgtcggc
aacggcaacgacctggagctgaccgccgcggacaaggccgccgtggacaaggtgtgcggc
gccatgaagtgcgcggtgctgatcgtctccggacggccccagctgatcggcgaccggctc
ggcgacatcgacgcgctcgtcgcgtcctggctgccgggcacggagggcgacggcgtcgcc
gacgtgctgtacggcaagcgggcgttcaccggtcaactcccggtcacctggccgaagtcg
gaggcccagctgccgatcaacgtcggtgacacgacgtacgatccgcagttcccgtacggc
tggggtctgaccacgctgacgaaggtgccggccggcggtgcggcgacgctgaaggcactg
gcggtcgcggcggcggtggccgagaggaccggttccggcaaggccggacgcgctctggtc
ggcaaggcgcggctgctcgtccagcagaaggccggatcgggaccggggatcaccgcggcg
gtcgcggggccgttcgccgacgcggaccatctgctgctgaccgggaagtacggggcggcg
gtcgcgaagctgacggaggcctaccgggccgcctga

KEGG   Streptomyces avermitilis: SAVERM_5253
Entry
SAVERM_5253       CDS       T00126                                 

Gene name
bglC2
Definition
(GenBank) putative beta-glucosidase
  KO
K05350  beta-glucosidase [EC:3.2.1.21]
Organism
sma  Streptomyces avermitilis
Pathway
sma00460  Cyanoamino acid metabolism
sma00500  Starch and sucrose metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SAVERM_5253 (bglC2)
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    SAVERM_5253 (bglC2)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     SAVERM_5253 (bglC2)
SSDB
Motif
Pfam: Glyco_hydro_1
Other DBs
NCBI-ProteinID: BAC72965
NITE: SAV5253
UniProt: Q82CT5
Position
complement(6364894..6366342)
AA seq 482 aa
MASAETSAAPVSPVTFPPAFLWGAATSAYQIEGAVREDGRTPSIWDTFSHTPGKTAGGET
GDIAVDHYHRYRDDVALMAELGLGAYRFSVSWSRVQPMGRGPAVQRGLDFYRRLVDELLA
HGVKPALTLYHWDLPQELEDAGGWPERDTAYRFAEYAQIVGDALGDRVEQWITLNEPWCS
AFLGYGSGVHAPGRTDAAASLRAAHHLNLAHGLGTSALRAAMPARNTVAVSLNSSVVRTV
SDSPADVAAGRRIDDLANGVFHGPMLHGAYPAGLFAATASVTDWSFVQDGDLEAVNQPLD
ALGLNYYTPTLVSATESAPAGPRADGHGASSFSPWPGADDVVFHLTPGERTEMGWSIDPT
GLHELIMRYTREAPGLPLYITENGAAYDDKPDPEGRVHDPERIAYLHGHLTAVRRAITDG
ADVRGYYLWSLMDNFEWAYGYGKRFGAVYVDYATLARTPKSSARWYAQAARTGTLPGATA
AE
NT seq 1449 nt   +upstreamnt  +downstreamnt
gtggcatccgccgagacctccgcggcacctgtgtcgcccgtgacgtttcctcccgccttc
ctctggggcgcggcgacctccgcgtaccagatcgagggggcggtgcgggaggacggccgc
acgccctcgatctgggacaccttcagccatacgccgggaaagacggccggtggcgagacc
ggtgacatcgctgtcgaccactaccaccgctatcgcgacgacgtggcgctgatggcggag
ctcggccttggcgcgtaccgcttctcggtctcgtggtcgcgggtgcagccgatgggccgg
ggccccgcggtccagcgcggcctggacttctaccgccggctggtggacgaactcctcgcc
cacggcgtcaaaccggcgctcaccctctaccactgggacctgccgcaggagctggaggac
gcgggcggctggcccgagcgcgacaccgcgtaccggttcgcggagtacgcgcagatcgtg
ggtgacgcgctgggcgaccgcgtcgagcagtggatcacgctgaacgagccgtggtgcagc
gccttcctgggctacggctccggggtgcacgcgccgggccgcacggacgcggcggcttcg
ttgcgcgcggcgcaccatctgaacctggcgcacggcctgggcacctccgcgctgagggcc
gcgatgccggcccgcaacacggtcgcggtgagcctcaactcatcggtggtcaggaccgtt
tcggacagtcccgcggatgtggccgcgggccggcggatcgacgacctggccaacggggtc
ttccacggcccgatgctgcacggcgcgtatccggcggggctgttcgcggcgacggcctcg
gtgacggactggtcgttcgtccaggacggcgacctggaggcggtcaaccagccgctggac
gcgctggggttgaactactacacgccgacgctggtctcggcgacggagtcggccccggcg
ggcccccgcgcggacggccacggagcgagctccttctccccctggccgggcgcggacgac
gtcgtgttccacctgacccccggcgagcgcacggagatgggctggtcgatcgacccgacc
ggcctgcacgaactgatcatgcgttacacgcgggaggcgcccgggctgcccctgtacatc
accgagaacggcgcggcgtacgacgacaagccggacccggagggccgggtgcacgacccc
gagcggatcgcgtatctgcacggccatctgacggcggtccggcgggcgatcaccgacggc
gcggacgtccgcggctattacctctggtccctgatggacaacttcgagtgggcgtacggc
tacggcaagcgtttcggcgcggtgtacgtggactacgcgacgctggcccgtacgccgaag
tcgagcgcgcggtggtacgcgcaggcggcccggacggggacgctgccgggggcgacagcc
gccgagtag

KEGG   Streptomyces avermitilis: SAVERM_5598
Entry
SAVERM_5598       CDS       T00126                                 

Gene name
bglC3
Definition
(GenBank) putative beta-glucosidase
  KO
K05350  beta-glucosidase [EC:3.2.1.21]
Organism
sma  Streptomyces avermitilis
Pathway
sma00460  Cyanoamino acid metabolism
sma00500  Starch and sucrose metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SAVERM_5598 (bglC3)
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    SAVERM_5598 (bglC3)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     SAVERM_5598 (bglC3)
SSDB
Motif
Pfam: Glyco_hydro_1
Other DBs
NCBI-ProteinID: BAC73310
NITE: SAV5598
UniProt: Q82BV6
Position
complement(6771191..6772516)
AA seq 441 aa
MIRRMATNPISQFPAGFLWGVSTSAHQIEGAADEREPSVWDAFTAEPGRVKDGSTAAVAC
DHYHRYAEDVALLADLGVDAYRFSVSWPRVNSPGGLDFYDRLVDELCAAGVRPVPTLFHW
DLPLALDWLDRDTAARFAEYAARVAERLGDRVTKWITLNEPAEHTLLGHALGAHAPGRQL
LFDALPAAHHQLLAHGLAVRALRAAGVTDIGIANSHGPTWPASQEPADLEAAAFYDLLLN
RLFSDPLLLGRYPEGIGELMPKGSAGIESDLKVIAEPIDWYGINYYAPTKVGAPQGAEIE
FGGLTLPAELPFSVREIEGHPVTDFGWPVVPQALTELLTGFRERFGDRLPPIVITENGCS
YEGIDDQERIAYLDGHVRALHRAVEAGVDVRGYFVWSLLDNFEWAEGYERRFGLVHVDYD
TLERTPKASYGWLRDALRARR
NT seq 1326 nt   +upstreamnt  +downstreamnt
atgatccggcgcatggcgacgaacccgatatctcagttcccggccggcttcctgtggggt
gtctccacctcggcccaccagatcgagggagccgcggacgagcgcgagccctccgtgtgg
gacgccttcacggccgagccgggccgggtgaaggacggctcgacggcggcggtggcctgc
gaccactaccaccgctacgccgaggacgtggcgctcctcgccgacctgggcgtggacgcg
taccgcttctccgtgtcctggccccgggtgaactcacccggcggcctcgacttctacgac
cgcctggtcgacgagctgtgcgcggcgggcgtccgccccgtgccgacgctcttccactgg
gatctgcccctcgcgctggactggctcgaccgggacacggcggcgcggttcgccgagtac
gcggcacgcgtggccgagcgcctcggcgaccgggtgacgaagtggatcaccctcaacgag
cccgccgagcacaccctgctgggccacgcgctcggtgcgcacgcccccggcaggcagttg
ctcttcgacgcgctgccggcggcccaccaccagctcctcgcccacggtctggcggtacgg
gcgctgcgcgcggccggggtcaccgacatcggcatcgcgaactcgcacggaccgacctgg
ccggcctcccaggagccggcggacctggaggcggcggccttctacgacctcctcctcaac
cgcctgttctccgacccgctgctgctcggccggtacccggaggggatcggtgagctgatg
cccaaaggctcagcaggcatcgagtccgatctgaaggtcatcgcggagccgatcgactgg
tacggcatcaactactacgcgccgacgaaggtgggcgctccccagggcgcggagatcgag
ttcggcgggctcacccttcccgcggaactccctttctccgtacgggagatcgagggtcac
ccggtgacggacttcggctggccggtggtgcctcaggcgctgacggagttgctgacgggc
ttccgtgagcggttcggcgaccggctcccgccgatcgtcatcaccgagaacggctgctcg
tacgagggcatcgacgaccaggagcggatcgcctacctcgacggccatgtgcgggcgctc
caccgcgcggtggaggcgggcgtcgacgtgcgcggctacttcgtgtggtcgctgctggac
aacttcgagtgggcggaggggtacgagcgccgcttcgggctcgtacacgtcgactacgac
accctggagcggacgccgaaggcctcgtacggctggctgcgggacgcgctgcgggcgcgg
agatga

DBGET integrated database retrieval system