KEGG   Streptomyces avermitilis: SAVERM_1817
Entry
SAVERM_1817       CDS       T00126                                 

Gene name
sucD1
Definition
(GenBank) putative succinyl-CoA synthetase alpha subunit
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
sma  Streptomyces avermitilis
Pathway
sma00020  Citrate cycle (TCA cycle)
sma00640  Propanoate metabolism
sma00660  C5-Branched dibasic acid metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
Module
sma_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sma_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SAVERM_1817 (sucD1)
   00640 Propanoate metabolism
    SAVERM_1817 (sucD1)
   00660 C5-Branched dibasic acid metabolism
    SAVERM_1817 (sucD1)
Enzymes [BR:sma01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     SAVERM_1817 (sucD1)
SSDB
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Other DBs
NCBI-ProteinID: BAC69528
NITE: SAV1817
UniProt: Q82M43
Position
complement(2225284..2226183)
AA seq 299 aa
MAIYLTKESKVLVQGMTGGEGMKHTRRMLAAGTDVVGGVNPRKAGRAVDFDERTVPVFGS
VREGREATGADVTVVFVPPAFAKAAVVEAADAGIALTVVITEGIPVHDAVAFHAYAAAKG
TRIIGPNCPGLISPGQSNAGIIPADITKPGRIGLVSKSGTLTYQLMYELRDIGFSTCVGI
GGDPVVGTSHIDCLAAFEADPDTELIVLIGEIGGDAEERAAAYVRDHVTKPVVGYIAGFT
APEGRTMGHAGAIVSGSSGTARAKKEALEGAGVQVGGTPTATARLVLARLEAERDVTHS
NT seq 900 nt   +upstreamnt  +downstreamnt
atggccatctacctcaccaaggagagcaaggtcctcgtccagggcatgaccggcggcgag
ggcatgaagcacacccgccgcatgctcgcggcgggcacggacgtcgtcggcggggtcaac
ccgcgcaaggcgggccgtgccgtcgacttcgacgagcggaccgtccccgtgttcggctcg
gtgcgcgagggaagggaggcgaccggcgccgacgtcaccgtcgtcttcgtaccgcctgcc
ttcgccaaggcggccgtcgtcgaggccgccgacgccggaatcgcgctcaccgtcgtcatc
accgagggcatcccggtccacgacgcggtcgccttccacgcgtacgccgccgccaagggc
acccggatcatcggccccaactgccccggcctgatctcccccggccagtccaacgcgggc
atcatccccgccgacatcaccaagcccggccgcatcggcctcgtctccaagtccggcacc
ctcacctaccagctcatgtacgagctgcgcgacatcggcttctcgacgtgcgtcggcatc
ggcggggacccggtcgtcggcacgagccacatcgactgcctggccgccttcgaggcggac
cccgacaccgaactcatcgtcctgatcggcgagatcggcggcgacgcggaggaacgggcg
gccgcgtacgtccgcgaccacgtcaccaagcccgtcgtcggctacatcgccggattcacc
gcccccgagggcaggaccatggggcacgcgggggcgatcgtgtccggttcgtccggcacc
gcgcgggcgaagaaggaggccctggagggcgcgggcgtgcaggtgggcggcacgccgacc
gcgacggcacggctggtgctggcccgactggaagcggagcgtgacgtcactcatagttga

KEGG   Streptomyces avermitilis: SAVERM_1818
Entry
SAVERM_1818       CDS       T00126                                 

Gene name
sucC1
Definition
(GenBank) putative succinyl-CoA synthetase beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
sma  Streptomyces avermitilis
Pathway
sma00020  Citrate cycle (TCA cycle)
sma00640  Propanoate metabolism
sma00660  C5-Branched dibasic acid metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
Module
sma_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sma_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SAVERM_1818 (sucC1)
   00640 Propanoate metabolism
    SAVERM_1818 (sucC1)
   00660 C5-Branched dibasic acid metabolism
    SAVERM_1818 (sucC1)
Enzymes [BR:sma01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     SAVERM_1818 (sucC1)
SSDB
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A HTH_IclR
Other DBs
NCBI-ProteinID: BAC69529
NITE: SAV1818
UniProt: Q82M42
Position
complement(2226195..2227325)
AA seq 376 aa
MDLYEHQARELFADHGILVPRAEVTDSSQEARVIARRLGGRVVVKAQVKTGGRGKAGGVK
LAADPAAAELTARQILGMDIKGHTVGKVMLAEPVDIEAEFYVSYVLDRAAGRFLAIASAE
GGMEIEEVAATRPEAVARVPVDPAEGVTSAKAAEIAEAAGLPPATVDVLVRLWEVLLRED
AVLVEVNPLVRTAQGQILALDGKVTLDDNARFRQTRWGAEAAEHGDQLEAAAAAKGLNYV
KLDGEVGIIGNGAGLVMSTLDVVAGCGARPANFLDIGGGASAQIMADGLSVILSDPAVKS
VFVNVFGGITACDAVADGIVQALDTVRLTKPLVVRLDGNNAARGRAILDGRRHPLVQQVT
TMDGAARRAAQLADAG
NT seq 1131 nt   +upstreamnt  +downstreamnt
atggacctgtacgaacaccaggcaagggaactcttcgcggaccacggcatcttggtgccg
agggccgaggtcaccgactcgtcccaggaggcgcgcgtcatcgcccgcaggctcggcggc
cgcgtcgtagtgaaggcgcaggtcaagaccggtggccgcggcaaggcgggtggtgtgaag
ctcgccgcggaccccgccgccgccgaactcacggcgcgccagatcctcggcatggacatc
aagggacacacggtcggcaaggtgatgctggccgaacccgtcgacatcgaggcagagttc
tacgtctcctacgtactcgaccgcgcggccggccgcttcctcgccatcgcctccgcggaa
ggcggcatggagatcgaggaggtggccgccacccgcccggaagccgtggcgcgtgtcccc
gtcgacccggccgagggtgtcacctccgcgaaggcggccgagatcgcggaagcggccggg
cttcccccggcgaccgtcgacgtactcgtccggctctgggaggtactgctccgcgaggac
gccgtactggtcgaggtgaacccgctcgtgcgtacggcgcaggggcagatcctcgccctc
gacggcaaggtcacgctcgacgacaacgcccgcttccggcagacgcgttggggcgccgaa
gccgcggagcacggcgatcagctggaggcggcggcagcggccaaggggctcaactacgtg
aagctggacggcgaggtcggcatcatcggcaacggagcgggcctcgtcatgtcgacgctc
gacgtggtcgcgggctgcggggcccgccccgccaacttcctcgacatcggcggcggcgcc
tccgcccagatcatggccgacggcctgtccgtcatcctctccgacccggccgtgaagtcc
gtcttcgtcaacgtcttcggcgggatcaccgcctgcgacgcggtcgccgacgggatcgtg
caggccctggacaccgtccggttgaccaagccgctcgtggtccgcctggacgggaacaac
gcggcacgggggcgggcgatcctcgacggccgccggcaccccctggtccagcaggtcacc
accatggacggcgccgcgcgccgcgccgcccaactcgccgacgccggctga

KEGG   Streptomyces avermitilis: SAVERM_3451
Entry
SAVERM_3451       CDS       T00126                                 

Gene name
sucD2
Definition
(GenBank) putative succinyl-CoA synthetase alpha subunit
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
sma  Streptomyces avermitilis
Pathway
sma00020  Citrate cycle (TCA cycle)
sma00640  Propanoate metabolism
sma00660  C5-Branched dibasic acid metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
Module
sma_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sma_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SAVERM_3451 (sucD2)
   00640 Propanoate metabolism
    SAVERM_3451 (sucD2)
   00660 C5-Branched dibasic acid metabolism
    SAVERM_3451 (sucD2)
Enzymes [BR:sma01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     SAVERM_3451 (sucD2)
SSDB
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2 DapB_N
Other DBs
NCBI-ProteinID: BAC71163
NITE: SAV3451
UniProt: Q82HQ7
Position
complement(4274601..4275485)
AA seq 294 aa
MAIFLNKDSKVIVQGMTGATGMKHTKLMLADGTNIVGGVNPRKAGTSVDIDGTDIPVFGS
VAEAIEKTGANVSVLFVPPAFAKAAVVEAIDAEIPLAVVITEGIAVHDSAAFWAYAKSKG
NKTRIIGPNCPGLITPGQSNAGIIPGDITKPGRIGLVSKSGTLTYQMMYELRDIGFSSAV
GIGGDPIIGTTHIDALAAFEADPDTDLIVMIGEIGGDAEERAADFIAKNVTKPVVGYVAG
FTAPEGKTMGHAGAIVSGSSGTAAAKKEALEAAGVKVGKTPTETAKLARAILGS
NT seq 885 nt   +upstreamnt  +downstreamnt
atggctatcttcctcaacaaggacagcaaggtcatcgtccagggcatgaccggtgccacg
ggcatgaagcacaccaagctcatgctggccgacggcacgaacatcgtcggcggtgtgaac
ccgcgcaaggcgggcacgtccgtcgacatcgacggcaccgacatcccggtgttcggctcg
gtagccgaggccatcgagaagacgggcgccaacgtgtccgtcctcttcgtgccgccggct
ttcgccaaggccgccgtcgtcgaggccatcgacgcggagatccccctcgcggtcgtcatc
accgagggcatcgccgtccacgactccgccgccttctgggcgtacgcgaagtcgaagggc
aacaagacccgcatcatcggcccgaactgccccggtctcatcacgccgggccagtcgaac
gccggcatcatcccgggcgacatcacgaagccgggccgcatcggcctggtctcgaagtcc
ggcacgctgacgtaccagatgatgtacgagctccgtgacatcggcttctcgtcggccgtc
ggcatcggtggcgacccgatcatcggtacgacgcacatcgacgcgctcgccgcgttcgag
gccgaccccgacaccgacctgatcgtcatgatcggtgagatcggcggcgacgccgaggag
cgtgcggcggacttcatcgcgaagaacgtgacgaagccggtcgtcggctacgtcgccggc
ttcaccgcgcccgagggcaagaccatgggccacgccggcgccatcgtctccggctcctcc
ggcacggccgccgcgaagaaggaggccctcgaggccgccggcgtcaaggtcggcaagacg
ccgaccgagacggcgaagctggcgcgcgccatcctcggcagctga

KEGG   Streptomyces avermitilis: SAVERM_3452
Entry
SAVERM_3452       CDS       T00126                                 

Gene name
sucC2
Definition
(GenBank) putative succinyl-CoA synthetase beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
sma  Streptomyces avermitilis
Pathway
sma00020  Citrate cycle (TCA cycle)
sma00640  Propanoate metabolism
sma00660  C5-Branched dibasic acid metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
Module
sma_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sma_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SAVERM_3452 (sucC2)
   00640 Propanoate metabolism
    SAVERM_3452 (sucC2)
   00660 C5-Branched dibasic acid metabolism
    SAVERM_3452 (sucC2)
Enzymes [BR:sma01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     SAVERM_3452 (sucC2)
SSDB
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Other DBs
NCBI-ProteinID: BAC71164
NITE: SAV3452
UniProt: Q82HQ6
Position
complement(4275507..4276685)
AA seq 392 aa
MDLFEYQARDLFAKHGVPVLAGEVIDTPEAAREATERLGGKSVVKAQVKVGGRGKAGGVK
LAATPDEAVARATDILGMDIKGHTVHKVMIAETAPEILEEYYVSYLLDRTNRTFLAMASV
QGGMDIEEVAEKTPEALAKVPVDAVEGVSIEKAREIVALAKFPAEVAEKVAEVLVTLWDT
FVAEDALLVEVNPLAKVASGDILALDGKVSLDENAEFRQADHAALEDKASANPLEAAAKE
KNLNYVKLDGEVGIIGNGAGLVMSTLDVVAYAGENHGGVKPANFLDIGGGASAQVMANGL
EIILGDPDVKSVFVNVFGGITACDEVANGIVQALQLLADKGEEVTKPLVVRLDGNNAELG
RRILSDANHPLVQRVDTMDGAADKAAELAAAK
NT seq 1179 nt   +upstreamnt  +downstreamnt
gtggacctgttcgagtaccaggcgagggacctcttcgccaagcacggtgtaccggtgctg
gccggtgaagtcatcgacacgcctgaggcggcccgcgaggcgaccgagcgtcttggcggc
aagtccgtcgtcaaggcccaggtgaaggtcggtggccgcggcaaggccggtggcgtgaag
ctcgccgccaccccggacgaggccgtcgctcgcgcgacggacatcctcggcatggacatc
aagggccacacggtccacaaggtgatgatcgccgagacggctccggagattcttgaggag
tactacgtctcgtacctcctcgaccgcaccaaccgcaccttcctcgccatggcgtccgtt
cagggcggcatggacatcgaggaggttgccgagaagacccccgaggcccttgcgaaggtc
ccggtcgacgctgtggaaggcgtctccatcgagaaggcccgcgagatcgtcgccctggcg
aagttcccggccgaggtcgccgagaaggtcgccgaggtcctcgtgaccctgtgggacacc
ttcgtcgccgaggacgcgctcctcgtcgaggtcaacccgctcgccaaggtcgcctccggc
gacatcctggcgctggacggcaaggtctccctggacgagaacgccgagttccgccaggcc
gaccacgccgccctcgaggacaaggcgtcggccaacccgctcgaggccgccgccaaggag
aagaacctcaactacgtcaagctcgacggcgaggtcggcatcatcggcaacggcgcgggt
ctcgtcatgagcaccctcgacgtcgtcgcgtacgctggtgagaaccacggcggagtcaag
cccgccaacttcctcgacatcggcggcggcgcttccgcgcaggtcatggccaacggtctc
gagatcatcctcggtgacccggacgtcaagtccgtcttcgtcaacgtcttcggtggcatc
accgcctgtgacgaggtcgccaacggcatcgtgcaggcgctgcagctgctcgccgacaag
ggcgaggaagtcaccaagccgctggtcgtgcgtctcgacggcaacaacgccgagctgggc
cgcaggatcctgtcggacgccaaccacccgctggtccagcgcgtggacaccatggacggc
gcggccgacaaggccgccgagctcgcggctgcgaagtaa

DBGET integrated database retrieval system