KEGG   Streptomyces avermitilis: SAVERM_1819Help
Entry
SAVERM_1819       CDS       T00126                                 

Gene name
ilvB3
Definition
(GenBank) putative TPP-requiring enzyme (acetolactate synthase II)
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
sma  Streptomyces avermitilis
Pathway
sma00290  Valine, leucine and isoleucine biosynthesis
sma00650  Butanoate metabolism
sma00660  C5-Branched dibasic acid metabolism
sma00770  Pantothenate and CoA biosynthesis
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01210  2-Oxocarboxylic acid metabolism
sma01230  Biosynthesis of amino acids
Module
sma_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
sma_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SAVERM_1819 (ilvB3)
   00660 C5-Branched dibasic acid metabolism
    SAVERM_1819 (ilvB3)
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    SAVERM_1819 (ilvB3)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SAVERM_1819 (ilvB3)
Enzymes [BR:sma01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     SAVERM_1819 (ilvB3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_C TPP_enzyme_M
Motif
Other DBs
NCBI-ProteinID: BAC69530
NITE: SAV1819
UniProt: Q82M41
Position
2227504..2229198
Genome map
AA seq 564 aa AA seqDB search
MPDGSSDNNSDLISGGHLVAKALKAEGVEVIYTLCGGHIIDIYDGCVDEGIKVVDVRHEQ
VAAHAADGYARITGKPGCAVVTAGPGTTDAVTGVANAFRAESPMLLIGGQGAHTQHKMGS
LQDLPHVDMMTPITKFAATVPDTARAADMVSMAFRECYHGAPGPSFLEIPRDVLDARVPV
SKARIPAAGQYRASTRSAGDPEAVEQLADLLVHAEKPAILLGSQVWTTRGTEAAVDLVRT
LNIPAYMNGAGRGTLPPGDPHHYQLSRRYAFSNADVIVVVGTPFDFRMGYGKRLSPDATV
VQIDLDYRTVGKNRDIDLGIVGDAGLILKSVTEAASGRLNGGASKRKEWLDELRAAEQTA
LDKRLPSLRSDASPIHPYRLVSEINDFLTEDSVYIGDGGDIVTFSGQVVQPKSPGHWMDP
GPLGTLGVGIPFVLAAKQARPDKEVVALFGDGAFSLTGWDFETLVRYDLPFVGIVGNNSS
MNQIRYGQAQKYGLARERVGNTLGDVHYDKFAQMLGGYGEEVRDPADIGPALRRARESGK
PSLINVWVDPDAYAPGTMNQTMYK
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgcccgacggcagcagcgacaacaactcggacctcatctccggtgggcacctggtcgcc
aaggcactcaaagcggagggggtggaggtcatctacaccctgtgcggcggccacatcatc
gacatctacgacggctgcgtggacgagggcatcaaggtcgtcgacgtgcgtcacgagcag
gtcgccgcgcacgccgccgacggctacgcgcgcatcaccggcaagcccggctgcgcggtc
gtcacggcgggtcccggcaccaccgacgccgtgaccggtgtcgccaacgccttccgcgcg
gagtccccgatgctgctgatcggcggccaaggggcgcacacacagcacaagatggggtcg
ctccaggacctcccgcacgtcgacatgatgacgccgatcaccaagttcgcggcgaccgtg
ccggacacggcgcgcgccgccgacatggtgtcgatggcgttccgcgagtgctaccacggc
gcaccgggcccctccttcctggagatcccgcgcgatgtcctcgacgccagggtgccggtg
agcaaggcccggattcccgccgccggccagtaccgggcctcgacccgctcggccggcgat
cccgaggcggtcgagcagctcgccgacctcctcgtgcacgcggagaaaccggcgatcctg
ctgggcagccaggtgtggacgacacgtgggaccgaggccgccgtcgacctcgtgcgcacc
ctcaacatcccggcgtacatgaacggcgccgggcgcggcacgctgccgcccggggacccg
caccactaccagctgtcgcgccggtacgcgttctccaacgccgacgtcatcgtcgtcgtc
ggtacgccgttcgacttccgcatgggctacggcaagcggctgtcgccggacgcgaccgtc
gtgcagatcgacctcgactaccggaccgtcggcaagaaccgggacatcgacctcgggatc
gtcggcgacgcggggctgatcctgaagtcggtcaccgaggcggcctccgggcgcctcaac
ggaggcgcgtcgaagcgcaaggagtggctggacgaactgcgcgccgccgagcagacggcc
ctcgacaagcggctgcccagcctgaggtccgacgcctcacccatccacccgtaccggctg
gtcagcgagatcaacgacttcctcaccgaggactccgtctacatcggcgacggcggtgac
atcgtcaccttctccgggcaggtcgtgcagcccaagtcgcccggacactggatggacccg
ggtccgctgggcacactcggcgtcggcatcccgttcgtgctcgcggccaagcaggcgcgg
cccgacaaggaagtggtggccctcttcggcgacggcgcgttctccctcaccggctgggac
ttcgagaccctcgtccgctacgacctccccttcgtcggcatcgtcggcaacaactcctcg
atgaaccagatccgctacggccaggcccagaagtacggcctggcccgcgagcgggtcggc
aacaccctcggcgacgtccactacgacaagttcgcccagatgctgggcggttacggcgag
gaggtccgcgaccccgccgacatcggcccggcgctgcggcgcgcccgcgagtcgggtaag
ccgtcgctgatcaacgtctgggtcgacccggacgcgtacgcccccggaaccatgaaccag
acgatgtacaagtga

KEGG   Streptomyces avermitilis: SAVERM_2732Help
Entry
SAVERM_2732       CDS       T00126                                 

Gene name
ilvN
Definition
(GenBank) acetolactate synthase subunit small
  KO
K01653  acetolactate synthase I/III small subunit [EC:2.2.1.6]
Organism
sma  Streptomyces avermitilis
Pathway
sma00290  Valine, leucine and isoleucine biosynthesis
sma00650  Butanoate metabolism
sma00660  C5-Branched dibasic acid metabolism
sma00770  Pantothenate and CoA biosynthesis
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01210  2-Oxocarboxylic acid metabolism
sma01230  Biosynthesis of amino acids
Module
sma_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
sma_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SAVERM_2732 (ilvN)
   00660 C5-Branched dibasic acid metabolism
    SAVERM_2732 (ilvN)
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    SAVERM_2732 (ilvN)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SAVERM_2732 (ilvN)
Enzymes [BR:sma01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     SAVERM_2732 (ilvN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALS_ss_C ACT ACT_5 ACT_4
Motif
Other DBs
NCBI-ProteinID: BAC70443
NITE: SAV2732
UniProt: Q82JM3
Position
complement(3353885..3354412)
Genome map
AA seq 175 aa AA seqDB search
MSKHTLSVLVENKPGVLARITALFSRRGFNIDSLAVGVTEHPDISRITIVVNVIEALPLE
QVTKQLNKLVNVLKIVELEPSAAVQRELVLVKVRADNETRSQIVEIVQLFRAKTVDVSPE
AVTIEATGGSDKLEAMLKMLEPFGIKELVQSGTIAIGRGARSITDRSLRALDRSA
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagcacaccctctccgtcctcgtcgagaacaagcccggtgtcctcgcccggatc
accgccctgttctcccggcgcggcttcaacatcgactcgctcgccgtcggtgtcaccgag
caccccgacatctcccgcatcaccatcgtggtgaacgtgatcgaggcactgccgctcgaa
caggtcaccaaacagctcaacaagctcgtcaacgtcctgaagatcgtcgagctggagccg
tccgcggccgtgcagcgcgaactcgttctggtgaaggtgcgcgccgacaacgagacgcgc
tcccagatcgtcgagatcgtccagctgttccgcgccaagaccgtggacgtctccccggag
gccgtcaccatcgaggccaccggcggcagcgacaagctggaggccatgctcaagatgctg
gagccgttcggcatcaaggagctcgtccagtccggaacgatcgcgatcggacgtggggca
cgttcgatcacggaccgctcgctgcgcgcgctggaccgatccgcgtaa

KEGG   Streptomyces avermitilis: SAVERM_2733Help
Entry
SAVERM_2733       CDS       T00126                                 

Gene name
ilvB1
Definition
(GenBank) acetolactate synthase subunit large
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
sma  Streptomyces avermitilis
Pathway
sma00290  Valine, leucine and isoleucine biosynthesis
sma00650  Butanoate metabolism
sma00660  C5-Branched dibasic acid metabolism
sma00770  Pantothenate and CoA biosynthesis
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01210  2-Oxocarboxylic acid metabolism
sma01230  Biosynthesis of amino acids
Module
sma_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
sma_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SAVERM_2733 (ilvB1)
   00660 C5-Branched dibasic acid metabolism
    SAVERM_2733 (ilvB1)
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    SAVERM_2733 (ilvB1)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SAVERM_2733 (ilvB1)
Enzymes [BR:sma01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     SAVERM_2733 (ilvB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C CO_dh POR_N Glyco_tran_WecB
Motif
Other DBs
NCBI-ProteinID: BAC70444
NITE: SAV2733
UniProt: Q82JM2
Position
complement(3354433..3356283)
Genome map
AA seq 616 aa AA seqDB search
MTEQATGAHHPQPRPRSGGQQSAPEHVTGAQSLIRSLEEVGAETVFGIPGGAILPAYDPL
MDSKRVRHVLVRHEQGAGHAATGYAQATGKVGVCMATSGPGATNLVTPIADAHMDSVPLV
AITGQVASKAIGTDAFQEADIVGITMPITKHNFLVTKAEDIPRTIAEAFHIASTGRPGPV
LVDIAKDALQAQTTFQWPPTPDLPGYRPVTKPHAKQIREAAKLITQAKRPVLYVGGGVLK
AKATAELKVLAELTGAPVTTTLMALGAFPDSHKLHVGMPGMHGAVTAVTALQKADLIVAL
GARFDDRVTGKLDSFAPYAKIVHADIDPAEIGKNRAADVPIVGDAREVIADLVQAVQKEH
SEGHAGDYTAWWKDLNRWRDTYPLGYEQPDNGSLSPQQVIERIGQLAPEGTIFAAGVGQH
QMWAAHYVKYEQPATWLNSGGAGTMGYAVPAAMGAKAGQPDRTVWAIDGDGCFQMTNQEL
TTCALNNIPIKVAIINNGALGMVRQWQTLFYNQRYSNTVLHSGPGADGKQPSAGTRVPDF
VKLSEAMGCYAIRCESPDDLDKVIAEANSVNDRPVVIDFIVHEDAMVWPMVAAGTSNDEV
MFARDVRPDFGDNEDD
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagcaggccaccggggcccaccatccgcagccgcggccccgttccggaggacag
cagtccgcccccgagcacgtcacgggcgcgcagtccctcatccgctcgctcgaggaggtc
ggggcggagacggtattcggtatccccggcggcgcgatcctcccggcctacgacccgctg
atggactcgaagcgcgtgcggcacgtgctcgtccggcacgagcagggcgcgggtcacgcg
gccaccggctacgcgcaggccaccggcaaggtcggcgtgtgcatggccaccagcggcccg
ggtgccaccaacctggtgaccccgatcgccgacgcccacatggactcggtgccgctcgtg
gcgatcaccgggcaggtcgcgtccaaggcgatcggtacggacgccttccaggaggcggac
atcgtcggtatcaccatgccgatcaccaagcacaacttcctggtgaccaaggccgaggac
atcccgcggacgatcgcggaggccttccacatcgcctccaccggccgtccgggcccggtc
ctcgtcgacatcgccaaggacgccctccaggcgcagaccaccttccagtggccgcccacc
ccggacctgcccggctaccgcccggtgaccaagccgcacgccaagcagatccgcgaggcc
gccaagctgatcacccaggccaagcggcccgtcctctacgtcggcggcggcgtcctcaag
gccaaggccaccgccgagctgaaggtcctcgcagaactcaccggagcgcccgtcaccacc
accctgatggcgctcggcgcattccccgacagccacaagctgcacgtgggaatgccgggc
atgcacggtgcggtcaccgccgtcaccgcgctgcagaaggccgacctgatcgtcgccctc
ggagcccgcttcgacgaccgcgtcaccggcaagctggacagcttcgccccgtacgccaag
atcgtgcacgccgacatcgacccggccgagatcggcaagaaccgcgccgcggacgtgccg
atcgtcggagatgcccgcgaggtcatcgccgacctggtccaggccgtgcagaaggagcac
agcgagggccacgccggcgactacaccgcctggtggaaggacctgaaccgctggcgcgac
acgtacccgctgggctacgagcagccggacaacggctcgctgtcgccgcagcaggtcatc
gagcgcatcgggcagctcgccccggagggcacgatcttcgcggcgggcgtcggccagcac
cagatgtgggccgcgcactacgtcaagtacgagcagcccgcgacctggctgaactccggc
ggcgccggaacgatgggctacgcggtcccggccgcgatgggcgccaaggccggtcagccg
gaccgtacggtctgggcgatcgacggcgacggctgcttccagatgaccaatcaggagctc
accacctgcgccctgaacaacatcccgatcaaggtcgccatcatcaacaacggcgccctc
gggatggtccgccagtggcagaccctcttctacaaccagcgctactccaacaccgtgctg
cacagcggcccgggcgcggacggaaagcagccgagcgccggcacccgcgtccccgacttc
gtgaagctgtcggaggccatgggctgctacgcgatccgctgcgagtccccggacgacctc
gacaaggtcatcgcggaggcgaactccgtcaacgaccgccccgtcgtgatcgacttcatc
gtccacgaggacgcgatggtctggccgatggtcgccgcaggcacctccaacgacgaggtc
atgttcgcccgggacgtccgccccgacttcggcgacaacgaagacgactga

KEGG   Streptomyces avermitilis: SAVERM_5286Help
Entry
SAVERM_5286       CDS       T00126                                 

Gene name
ilvB4
Definition
(GenBank) putative acetolactate synthase
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
sma  Streptomyces avermitilis
Pathway
sma00290  Valine, leucine and isoleucine biosynthesis
sma00650  Butanoate metabolism
sma00660  C5-Branched dibasic acid metabolism
sma00770  Pantothenate and CoA biosynthesis
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01210  2-Oxocarboxylic acid metabolism
sma01230  Biosynthesis of amino acids
Module
sma_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
sma_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SAVERM_5286 (ilvB4)
   00660 C5-Branched dibasic acid metabolism
    SAVERM_5286 (ilvB4)
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    SAVERM_5286 (ilvB4)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SAVERM_5286 (ilvB4)
Enzymes [BR:sma01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     SAVERM_5286 (ilvB4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_C TPP_enzyme_M
Motif
Other DBs
NCBI-ProteinID: BAC72998
NITE: SAV5286
UniProt: Q82CQ7
Position
6404409..6406094
Genome map
AA seq 561 aa AA seqDB search
MTHDHDLVLRPTAAETSAALNPPPGRNGGDLVVETLTGLGATTVFGLPGQHALGMFDALR
RSDLRYIGLRVENNAGFAADAYGRITGEAAPLLLSTGPGALTSLAALQEAAAASAPVLAI
SSQIPTAGLGGGRHGYLHELPDQQASFRGVVKSVHTVRTQSQIPSAIAAAWESALTVPHG
PVWVEIPQDVLLAETSLPVVTALDATPEDVVPRPELTAVAAHLLSNAARPAIIAGGGVVR
ADAAGKLRALAEKLDAPVITTFGGKGAFPWEHPLSLQSWLEDRHTTDFLEDADVLLVVGS
GLGELSSNYHTFKPRGRVIQIEADLGKLESNHPALGIHADARLALSALLETVGERTDPTA
ADRVRTVLTRVRERIAAQELTLEQDVLASVRRALPDDSPSFWDMTILAYWAWSAFDPRGS
NSMHSAQGAGGLGYGFPAALGAAAADPTRPVLAVSGDGGALYSIAELATAKQYDLNVTWL
IVDDGGYGILREYMTDTFGEATATELSRPDYVALAESFGVSGVRTTRETLEVDLAKALAT
PGPSVVLLPAVLRMFAPTHLG
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
gtgacccacgaccacgacctggtgcttcgccccacggccgccgagacgtcagccgcgttg
aacccacccccggggcgcaatggcggggacctggtcgtggagaccctcaccggtctcggc
gcgacgaccgtcttcggcctgccgggccagcacgcgctcggcatgttcgacgcgctgcgg
cggtcggacctgcggtacatcggcctgcgggtggagaacaacgcgggtttcgcggcggac
gcgtacgggcggatcaccggggaggcggccccgctgctgctctccaccggccccggcgcc
ctcacctccctggccgcgctccaggaggcggcggcggcctcggcgcccgtcctcgcgatc
agcagccagatcccgaccgccggactgggcggcggccgccacggctatctgcacgaactc
ccggaccagcaggcgtcgttccggggtgtggtgaagtccgtccacacggtccgtacgcag
tcgcagatcccgtcggcgatcgcggcggcctgggagtcggcgctgacggttccgcacggc
ccggtgtgggtggagatcccgcaggacgtcctgctcgccgagacgagcctgccggtggtg
acggcgctcgacgcgacaccggaggacgtggtcccgcgccccgaactgacggcggtggcg
gcccacctgctgtcgaacgccgcccgccccgcgatcatcgccggcggcggggtcgtacgg
gcggacgcggccggaaagctgagggcgctggccgagaagctggacgcccccgtgatcacg
accttcggcggcaagggcgccttcccctgggagcacccgctgtcgctccagtcctggctg
gaggaccgtcacacgacggacttcctggaggacgcggacgtcctcctggtggtcggctcg
gggctcggcgaactgtcctcgaactaccacacgttcaagccgcgcggccgggtgatccag
atcgaggccgacctcggcaagctggagtccaaccacccggcactgggcatccacgcggac
gcccggctggcactctccgcgctcctggagacggtcggggaacgcaccgacccgacggcg
gcggaccgcgtacgcaccgtcctcacccgcgtccgtgaacgcatcgccgcccaggaactc
accctggaacaggacgtactggcgtccgtgcgccgggccctgccggacgactccccgtcg
ttctgggacatgacgatcctggcctactgggcgtggtccgccttcgacccccgcggctcc
aactccatgcactccgcgcagggcgcgggcggtctcggctacggcttcccggcggccctc
ggcgcggccgcggccgaccccacccgcccggtcctggcggtctcgggtgacggcggagcc
ctgtactccatcgccgaactggccacggcgaagcagtacgacctgaacgtcacctggctg
atcgtcgacgacggcggctacggcatcctgcgcgagtacatgacggacaccttcggcgag
gcgacggcgaccgagctgtcccgcccggactatgtggccctcgcggagtcgttcggggtg
tcgggggtgcggacgacccgcgagacgctggaagtggacctggcgaaggcgctggcgacc
ccggggccgtcggtggtgctgctgccggcggtgctgcggatgttcgcgccgacgcacctg
ggctga

DBGET integrated database retrieval system