KEGG   Streptomyces avermitilis: SAVERM_1895
Entry
SAVERM_1895       CDS       T00126                                 

Gene name
argI
Definition
(GenBank) putative arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
sma  Streptomyces avermitilis
Pathway
sma00220  Arginine biosynthesis
sma00330  Arginine and proline metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    SAVERM_1895 (argI)
   00330 Arginine and proline metabolism
    SAVERM_1895 (argI)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     SAVERM_1895 (argI)
SSDB
Motif
Pfam: Arginase
Other DBs
NCBI-ProteinID: BAC69606
NITE: SAV1895
UniProt: Q82LW5
Position
complement(2317670..2318566)
AA seq 298 aa
MRSIVVLDAPSNLGLRPPAPGTVPGCYKLAGALREQRIVQRLGALEGGVVVPPRYDRGEW
QEGDGVFNAAALASYTRKLADRIEHHVRAGDLPVVLGGDCSIQLGASLALRRIGRYGLAA
VDASADFRHPGNSDRVGAAGGEELALATGRGQEDLTDIEGLRPYLRDEDVRLFGIRDDDP
ERTELGALKIATVTVGDLRAWGADALARATVEAFEIPQLQGFWVHLDADVLDPSVMPAVD
SPDPDGLLPDEVVALLRPLLRSPHCAGLNVTIYDPDLDPDGTAGALLADIVVSAFDAS
NT seq 897 nt   +upstreamnt  +downstreamnt
atgcgaagcatcgtcgtcctggacgccccctccaacctgggcctgcgcccgcccgccccg
ggcaccgtgcccggctgctacaagctcgccggcgcgctgcgggaacagcgcatcgtgcag
cgcctgggcgccttggagggcggcgtcgtcgtaccgccgcgctacgaccgcggggagtgg
caggagggcgacggcgtcttcaacgcggccgccctcgcctcgtacacccgcaagctggcc
gaccgcatcgaacaccatgtacgcgccggtgatctgccggtcgtcctcggcggcgactgc
tccatccagctcggcgcctcgctcgcactgcgccgcatcgggcggtacgggctggccgcg
gtggacgcctccgcggacttccgccaccccggcaactcggaccgcgtcggcgccgcgggc
ggcgaggaactggcgctggccaccgggcgggggcaggaggacctgaccgacatcgagggg
ctgcggccgtatctgcgggacgaggacgtacggctcttcggcatccgcgacgacgatccg
gagcggacggaactcggcgcgctgaagatcgcgaccgtcaccgtcggcgaccttcgcgca
tggggtgcggacgcgctcgcccgggccacggtggaggccttcgagataccgcaactccag
gggttctgggtgcacttggacgcggacgtcctcgatccgtccgtcatgcccgccgtcgac
agccccgacccggacgggctgctgcccgacgaggtcgtcgcgctgctgcggccgttgctg
cgctccccgcactgcgccggtctcaacgtcaccatctacgaccccgacctggacccggac
gggacggccggggcgctgctggccgacatcgtcgtgtccgcgttcgacgcgtcctga

DBGET integrated database retrieval system