KEGG   Streptomyces avermitilis: SAVERM_1918
Entry
SAVERM_1918       CDS       T00126                                 

Gene name
glxK
Definition
(GenBank) putative glycerate kinase
  KO
K00865  glycerate 2-kinase [EC:2.7.1.165]
Organism
sma  Streptomyces avermitilis
Pathway
sma00260  Glycine, serine and threonine metabolism
sma00561  Glycerolipid metabolism
sma00630  Glyoxylate and dicarboxylate metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SAVERM_1918 (glxK)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    SAVERM_1918 (glxK)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAVERM_1918 (glxK)
Enzymes [BR:sma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.165  glycerate 2-kinase
     SAVERM_1918 (glxK)
SSDB
Motif
Pfam: Gly_kinase
Other DBs
NCBI-ProteinID: BAC69629
NITE: SAV1918
UniProt: Q82LU2
Position
complement(2346527..2347678)
AA seq 383 aa
MADAGVNGTRRVLIAADKFKGSLTAVQVAERVTAGLRRVAPAVEVEALPVADGGDGTVDA
AVAAGFERRAVRVAGPLGEEVTAAFALRGGTAVVEMAEASGLQRLPKGVFAPLTASTYGS
GELLRAALDAGARTIVFGVGGSATTDGGAGMLAALGARFVDAEGEPVAPGGGGLSELALA
DLSGLDPRLAEIELVLASDVDNPLTGPKGAPAVYGPQKGAAPDDVATLDAALAHFAAVLE
KAIGPKAAEYAAAPGAGAAGGIGYGALVLGAGFRPGIEVMLDVLGFAPALDRATLVITGE
GSLDEQTLHGKAPAGVAAAARAAGKEVVAVCGRLALPPQELGRAGIRRAYPLTESEPDIA
KCIEDAGPILERVAENIARDFLV
NT seq 1152 nt   +upstreamnt  +downstreamnt
gtggcggacgctggagtcaacgggacccgcagggtgctcatcgccgcggacaagttcaag
gggtcgctgaccgccgtacaggtcgcggagcgtgtgacggccggcctgcgccgggtcgcg
cccgccgtggaggtcgaggcgctgcctgtggccgacggcggcgacgggaccgtggacgcg
gcggtcgcggccggattcgagcggcgtgcggtgcgggtcgccgggccgctcggcgaagag
gtcacggcggcgttcgcgctgcgcggcggcaccgcggtcgtggagatggcggaggcgagc
gggctgcaacggctgcccaaaggtgtcttcgcgccgctcacggcgtcgacgtacgggtcc
ggggaactgctgcgggccgcgctggacgccggggcgcggaccatcgtgttcggggtcggc
ggcagcgcgacgaccgacggcggggcgggcatgctggccgcgctcggtgcgcgcttcgtg
gacgcggagggcgagccggtggctcccgggggcggcggactgagcgagctcgccctggcc
gatctctcgggcctcgacccccgcctcgcggagatcgagctggtcctcgcgagcgacgtc
gacaatccgctgaccgggccgaagggcgcacccgcggtgtacgggccgcagaagggcgcc
gcaccggacgacgtggccacgctggacgcggcgctggcgcacttcgcggcggtgctggag
aaggcgatcgggccgaaggccgcggagtacgccgccgcgcccggtgcgggtgccgcgggc
ggcatcgggtacggggcgctggtgctcggcgccgggttccggcccggcatcgaggtgatg
ctggacgtgctcggcttcgcgccggcgctggaccgcgccacgctcgtgatcaccggcgag
gggtcgctggacgagcagacgctgcacgggaaggcgccggcgggtgtggccgcggcagct
cgggcggcgggcaaggaggtcgtcgcggtgtgcgggcggctcgccctgccgccgcaggag
ctggggcgggccggcatccggcgggcgtacccgctgacggagtccgagccggacatcgcg
aagtgcatcgaggacgcggggccgatcctggagcgggtcgcggagaacatcgcccgggac
ttcctggtctga

DBGET integrated database retrieval system