KEGG   Streptomyces avermitilis: SAVERM_1922Help
Entry
SAVERM_1922       CDS       T00126                                 

Gene name
gdh
Definition
(GenBank) putative glucose 1-dehydrogenase
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
sma  Streptomyces avermitilis
Pathway
sma00030  Pentose phosphate pathway
sma01100  Metabolic pathways
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SAVERM_1922 (gdh)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     SAVERM_1922 (gdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: BAC69633
NITE: SAV1922
UniProt: Q82LT8
Position
2350818..2351657
Genome map
AA seq 279 aa AA seqDB search
METTGSDGRQPLAPQLLKGQKALVTGANSGIGKATAIGLGRVGADVVVNYVAGRDAAEEV
VREIESFGVRAYAHEADVSQEDQVADMVSRMVKEFGTIDVMVANAGLQRDAPVIDMTMAQ
WQKVLDVNLTGQFLCAREAAKEFMRRGVVPEVSRSAGKIICMSSVHQIIPWAGHVNYAAS
KGGVLMMMATLAQELAPHRIRVNAVAPGAIRTPINRSAWDTPEAEADLLRLIPYRRVGDP
DDIANAVAALASDLFDYVVGTTIYVDGGMTLFPGFATGG
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaccaccggaagtgacggtcgccagccccttgccccccagctcctcaaaggacag
aaggcgctggtgacgggtgcgaattccggcatcggcaaggccacggcgatcggcctggga
cgcgtgggcgccgatgtggtggtgaattacgtggccgggcgggacgccgcggaagaggtg
gtgcgcgagatcgagagtttcggcgtccgcgcctacgcacacgaggcggacgtgtcacag
gaggaccaggtcgccgacatggtttcccgtatggtcaaggagttcgggaccatcgacgtc
atggtggcgaatgcgggactccagcgcgatgcccccgtcatcgacatgaccatggcccag
tggcagaaggtgctggacgtcaatctgaccggacaattcctgtgcgcccgtgaagcggcc
aaggaattcatgcggcgcggcgtcgtcccggaggtttcacgctcggcagggaaaatcatc
tgcatgagttcggtccaccagatcatcccctgggcgggccatgtgaactacgcggcgtcc
aagggcggggtgctgatgatgatggcgaccctcgcccaggagctggcaccccaccggatc
cgggtcaacgccgttgctccgggggcgattcgcacaccgatcaaccgcagcgcctgggac
accccggaggccgaggccgaccttctccggctcatcccctaccgccgcgtcggcgacccg
gacgacatcgcgaacgcggtggccgctctggcgtccgacctcttcgactacgtcgtgggg
accacgatctatgtggacggcggcatgacgctgttccccggtttcgccacgggtggctga

DBGET integrated database retrieval system