KEGG   Streptomyces avermitilis: SAVERM_1938Help
Entry
SAVERM_1938       CDS       T00126                                 

Gene name
ggt1
Definition
(GenBank) putative gamma-glutamyltranspeptidase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
sma  Streptomyces avermitilis
Pathway
sma00430  Taurine and hypotaurine metabolism
sma00460  Cyanoamino acid metabolism
sma00480  Glutathione metabolism
sma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    SAVERM_1938 (ggt1)
   00460 Cyanoamino acid metabolism
    SAVERM_1938 (ggt1)
   00480 Glutathione metabolism
    SAVERM_1938 (ggt1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sma01002]
    SAVERM_1938 (ggt1)
Enzymes [BR:sma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     SAVERM_1938 (ggt1)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     SAVERM_1938 (ggt1)
Peptidases and inhibitors [BR:sma01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   SAVERM_1938 (ggt1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: BAC69649
NITE: SAV1938
UniProt: Q82LS2
Position
complement(2370885..2372822)
Genome map
AA seq 645 aa AA seqDB search
MDLSRVTRTPQIPPRADPERRPIWPMSGNSEVRGRMFTTRPTLQGTFGMVSSTHWLASQS
AMAVLEEGGNAYDAAVAAGFVLHVVEPHLNGPGGEVPIILAPAGGEVRVLCGQGVAPAGA
TIEHYKGLGLDLVPGTGPLAAAVPGAFDAWMLLLRDYGTKSLADVLKYAIGYAQDGHAPV
ERVGETVETVRELFETEWVSSAEVYLPGGKAPRPGELFRNPALAATWKRLIAEVSGTGDR
VAQIERAREVWRGGFIAEALVRQSGRPTLDTSGERHTGTLTAADLASWAATYEAPATYDW
QGWTLCKAGPWSQGPVLLQQLALLPPELPRYGSADYVHLLIEGCKLAMADREAWYGDAAE
VPLAELLSDAYNAERRVLVGHKASYELRPGSPGGRTPRMSGHARVVAADEPEPAFGPPGA
GEPTVAKSPLSPVPGEPDIAADGGTRGDTCHLDVVDRWGNMIAATPSGGWLQSNPVVPEL
GFPLGTRLQMAWLDEGLPNSLTPGRRPRTTLTPSLALRDQVPVLAFGTPGGDQQDQWQTH
FFLAVVLRSGVRGGLDLQGAIDAPNWHNDSFPGSFYPRGTRPGSVTVESRTDPGVVEELR
RRGHDVLVGEAWSEGRLCAVARDPETGVLSAAANPRGMQGYAVGR
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
ttggatctctcgcgtgtgactcgaactccccagattccccccagggccgatcctgagcgc
cgaccgatctggccgatgagcggaaacagcgaggtgagaggccgtatgttcacgacccgc
cccaccctccagggcaccttcggcatggtgtcctccacgcactggctcgcctcccagtcg
gcgatggccgtcctggaggagggcggcaacgcctacgacgccgccgtcgccgccggtttc
gtcctgcatgtcgtcgagccgcacctcaacgggcccgggggagaggtgccgatcatcctc
gccccggcgggcggtgaggtgcgggtgctgtgcgggcagggagtcgcgccggccggagcc
acgatcgagcactacaagggactcggtctggatctcgtacccggtacggggccgctcgcg
gccgccgttccgggtgcgttcgacgcctggatgctcctcctgcgcgactacggaacgaag
tccctcgcggacgtcctcaagtacgccatcggatacgcgcaggacgggcacgcgcccgtg
gagcgcgtcggggagaccgtcgagacggtgcgcgagctgttcgagacggagtgggtctcg
tcggccgaggtgtatctgcccggcggaaaggcgccacggccgggtgaactgttccgcaac
ccggcgctcgccgcgacctggaaacggctgatcgccgaggtgtcgggcaccggagaccgg
gtggcccagatcgagagggcacgggaggtgtggcgtggcgggttcatcgccgaggcgctc
gtacgccagtccgggcggcccaccctggacaccagcggcgagcggcacaccggcacgctg
acggccgccgatctcgcctcctgggccgcgacctacgaggctccggcgacgtacgactgg
cagggctggacgctgtgcaaggccggcccctggagccagggcccggtcctcctccagcag
ctcgcgctgctcccgcccgagctgccgcgctatgggtccgccgactacgtccacctcctc
atcgagggctgcaagctcgccatggccgaccgtgaggcctggtacggcgacgcggccgag
gtgccgctggccgagctgctgtcggacgcgtacaacgccgagcggcgggtgctcgtcggc
cacaaggcctcgtacgagctgcgccccggcagcccgggcgggcggaccccgcggatgagc
gggcacgcacgcgtggtggccgccgacgaacccgagcccgcgttcggtcccccgggagcg
ggcgagcccaccgtcgccaagagcccgctgtccccggtgcccggggaaccggacatcgcg
gcggacgggggcacccggggcgacacctgccacctcgacgtcgtcgacaggtggggcaac
atgatcgcggccacgcccagcggcggctggctccagtccaacccggtcgtgcccgaactc
ggctttccgctcggtacccggctccagatggcctggctggacgagggcctgccgaactcc
ctcaccccgggccgccgcccccgcaccaccctcacgccctcgctggcgttgcgggaccaa
gtccccgtgctcgcgttcggcacgcccggcggcgaccagcaggaccagtggcagacccac
ttcttcctggccgtcgtcctgcgctccggggtccggggcggcctcgacctccagggcgcc
atcgacgccccgaactggcacaacgacagcttccccggctccttctacccgcgcgggacg
cgccccggcagtgtgaccgtcgagtcccgtacggaccccggggtcgtcgaggagctgcgg
cggcgcggccacgacgtcctggtcggcgaggcctggtccgaggggcggctgtgcgcggtc
gcccgggacccggagaccggtgtcctgtcggcggcggcgaacccgcgggggatgcagggg
tacgcggtcgggcgctga

KEGG   Streptomyces avermitilis: SAVERM_1957Help
Entry
SAVERM_1957       CDS       T00126                                 

Gene name
ggt2
Definition
(GenBank) putative gamma-glutamyltranspeptidase, secreted
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
sma  Streptomyces avermitilis
Pathway
sma00430  Taurine and hypotaurine metabolism
sma00460  Cyanoamino acid metabolism
sma00480  Glutathione metabolism
sma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    SAVERM_1957 (ggt2)
   00460 Cyanoamino acid metabolism
    SAVERM_1957 (ggt2)
   00480 Glutathione metabolism
    SAVERM_1957 (ggt2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sma01002]
    SAVERM_1957 (ggt2)
Enzymes [BR:sma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     SAVERM_1957 (ggt2)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     SAVERM_1957 (ggt2)
Peptidases and inhibitors [BR:sma01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   SAVERM_1957 (ggt2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: BAC69668
NITE: SAV1957
UniProt: Q82LQ3
Position
complement(2393820..2395619)
Genome map
AA seq 599 aa AA seqDB search
MRRPVARNLAVLAVSAAVVSVGAAAPPTAVTSVRKVPVAVGYGGAVSSVDADASAAGIEV
LKKGGNAVDAAVATAAALGVTEPYSSGIGGGGYFVYYDAKSRTVRTIDGRETAPLSADSH
LFEENGKALAFADAVTSGLSVGTPGSPATWQTALDKWGSKRLGTVLKPAERIARDGFTVD
STFRTQTASNEARFRYFPDTAKLFLPNGELPVVGSTFKNPDLARTYAELGTKGVDAVYRG
DLGEDIVATVNKPPVEPSSGWNARPGRLSAKDLEAYRAKLQAPTKTSYRGLDVYSMAPSS
SGGTTVGEALNILEKTDLSKADEVQYLHHYIEASRIAFADRGRWVGDPAFEDVPTKELLS
QKYADSRACLISDDAVLTSPLAPGDPRSPAKACATGGTAAPTTYEGENTTHLTVADKWGN
VVAYTLTIEQTGGSGITVPGRGFILNNELTDFSFTPANPAVHDPNLPGPGKRPRSSISPT
IVLDRHDKPVVALGSPGGATIITTVLQTLTGFLDRGLPLVDAIAAPRASQRNAAQTELEP
GLYDSTLRGKLEAIGHSFKLNPEIGAATGVQRLSNGKWLAAAEKVRRGGGSAMVVRPAS
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcggcctgtggcacggaatctggcggtgttggcggtttcggccgcggtggtgtcg
gtgggagcggcggctccacccaccgcggtcacctcggtgcggaaagttccggtcgccgtc
ggctacggcggtgccgtgtcgagcgtcgacgcggatgcctccgccgccggcatcgaggtg
ctgaagaagggcggcaacgcggtggacgcggccgtcgccaccgccgcggcgctcggcgtc
accgagccgtactcgtcgggcatcggcgggggcggctacttcgtctactacgacgccaag
tcccgtacggtgcgcaccatcgacggccgggagaccgcgccgctgtccgccgactcccac
ctgttcgaggagaacggcaaggcgctcgccttcgccgacgccgtcaccagcggcctgagc
gtgggcacgcccggctcgcccgccacctggcagaccgccctcgacaagtggggcagcaag
cggctcggcacggtgctgaagccggcggagcggatcgcgcgcgacggcttcacggtcgac
agcaccttccgcacccagaccgcctccaacgaggcccggttccgctacttcccggacacg
gcgaagctgttcctgccgaacggtgagctgccggtggtcggttccaccttcaagaacccc
gatctcgcccgcacctacgccgagctgggcaccaagggcgtcgacgcggtctaccgcggc
gatctcggcgaggacatcgtcgccaccgtgaacaagccgcccgtggagccaagttcgggc
tggaacgcccggcccggccgactctcggccaaagacctcgaggcctaccgcgcgaagctc
caggcgcccacgaagacctcgtaccggggcctcgacgtctactccatggccccctcctcc
tcgggcggcacgacggtcggcgaggcgctcaacatcctggagaagaccgacctgtcgaag
gccgacgaggtgcagtacctgcaccactacatcgaggccagccggatcgcgttcgcggac
cgggggcgctgggtgggcgaccccgccttcgaggacgtacccacgaaggaactgctgtcg
cagaagtacgccgactcgcgcgcgtgcctcatcagcgacgacgcggtgctgaccagcccg
ctggcgccgggtgatccgcgcagtccggcgaaggcctgcgccaccgggggcacggcggct
ccgacgacgtacgagggcgagaacaccacgcacctcacggtggccgacaagtggggcaac
gtcgtcgcctacacgctcaccatcgagcagaccggcggcagcggcatcacggtccccggc
cgcggcttcatcctgaacaacgaactgacggacttctccttcaccccggcgaacccggcc
gtgcacgacccgaacctgcccggccccggcaagcgcccgcgctcgtcgatctcgccgacg
atcgtgctcgaccggcacgacaagccggtcgtcgcgctcggttcgccgggcggcgcgacc
atcatcacgaccgtgctgcagaccctgaccgggttcctcgaccgcgggctgccgctggtc
gacgcgatcgccgcgccgcgcgccagccagcgcaacgcggcccagacggagctcgaaccg
ggcctgtacgacagcacgctcaggggcaagctggaagccatcgggcactccttcaagctg
aacccggagatcggcgcggcgacgggcgtgcagcgcctgtcgaacggcaagtggctggcc
gcggcggagaaggtgcgccggggcggcgggtcggcgatggtggtgcggccggcgtcgtag

DBGET integrated database retrieval system