KEGG   Streptomyces avermitilis: SAVERM_2004Help
Entry
SAVERM_2004       CDS       T00126                                 

Definition
(GenBank) putative siderophore biosynthesis protein/iron transport protein
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
sma  Streptomyces avermitilis
Pathway
sma03030  DNA replication
sma03430  Mismatch repair
sma03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SAVERM_2004
   03430 Mismatch repair
    SAVERM_2004
   03440 Homologous recombination
    SAVERM_2004
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sma03032]
    SAVERM_2004
   03400 DNA repair and recombination proteins [BR:sma03400]
    SAVERM_2004
Enzymes [BR:sma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     SAVERM_2004
DNA replication proteins [BR:sma03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     SAVERM_2004
DNA repair and recombination proteins [BR:sma03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     SAVERM_2004
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IucA_IucC FhuF
Motif
Other DBs
NCBI-ProteinID: BAC69715
NITE: SAV2004
UniProt: Q82LK6
Position
2443486..2444994
Genome map
AA seq 502 aa AA seqDB search
MHRPATAESELAAELDAVRPGLSAPYAAALPGARAAVLTRLWRALAHEPLPWIAHREPEP
GGLTLRLADGRRLHGPPSDPYATAPYVTGVRLDETSYAHPARLVSALGVPHGPALAAELD
HSVASLALSRAGQPRVDPKSPTTSWEWEQRVVDGHPFHPNCRSRPGFSAAEQLAYGPEHR
PVVRLGLVAVEECLVRGEWPKWLRDGERVLIPVHPWQTAHVLDAPVEDGPAAHPLMSLRT
LALRDGGPDVKTALSARLTSSVRDISVYSIETSATVSEFAEAFAARTDGLLHITRTLGAA
TAGRPELAAVVRESPDTYADAEAAERVVPVASLTGTGLPGSPAWLAEFTRLTLTVGLRLL
DLGVALEAHGQNLLVVLSATGAPLRLVYRDLADIRVSPARLARHGVPLPDLGGRLVTDDE
TTLRRKLFGSLVAGALAATAGSGPALREALAAAARDLPRTPDLTALLEEPLPAKALTLMR
LSPDRPGDSWAQLPNPLVTRAF
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
gtgcaccgtcccgccaccgcagagtccgagctcgccgccgagctcgacgccgtacggccc
ggcctgtcggcgccgtacgcggccgcgctcccgggcgcccgtgcggccgtcctgacccgg
ctgtggcgggcgctggcccatgagccgctgccgtggatcgcgcaccgggagccggagccc
ggcggactcacgctgcggctggccgacggacgccggctgcacggcccgccctcggacccg
tacgcgaccgctccgtacgtcaccggcgtgcggctcgacgagacgtcgtacgcgcatccg
gcccggctggtgtcggcgctcggcgtcccgcacggcccggccctggccgccgaactcgac
cacagtgtcgcctcgttggccctgtcgcgggccggtcagccgcgggtcgacccgaagtcg
ccgacgacgagctgggagtgggaacagcgggtggtcgacgggcatccgttccaccccaac
tgccgttcccggcccggcttttcggccgccgagcagctcgcttacgggcccgagcaccgg
ccggtggtgcggctgggcctcgtggccgtggaggagtgtctcgtccggggcgagtggccc
aagtggctgcgggacggggagcgcgtgctgattccggtccacccctggcagacggcacac
gtgctcgacgcaccggtggaggacgggccggccgcccacccgctgatgtccttgcggacc
ctcgcgctccgcgacggcggcccggacgtcaagaccgcgctcagcgcccggctgacatcg
tccgtgcgggacatctccgtgtactcgatcgagacgtccgcgacggtgtcggagttcgcc
gaggccttcgccgcccgcacggacggcctgctgcacatcacccgcaccctgggcgcggcc
acggccggccggcccgagctggccgcggtggtacgcgagtccccggacacgtacgccgac
gcggaggcggcggaacgtgtcgttccggtggcctcgctcaccggtaccgggctgcccggc
tctcccgcgtggctcgccgagttcacccggctcacgctcaccgtgggtctgcggctgctc
gacctgggcgtggccctggaggcgcacggccagaacctcctggtggtcctgtccgccacg
ggtgccccgctgcgcctcgtgtaccgcgacctcgccgacatccgcgtcagcccggcccgg
ctggcccggcacggtgtcccgctcccggatctcggcgggcgtctcgtcacggacgacgaa
accaccctgcgccgcaaactgttcggctccctcgtcgcgggcgcgctggcggcgacggcg
gggtcggggccggcgctgcgggaggcgctcgccgccgcggcgcgggatctgccgcgcacc
cccgatctgacggcgctgctcgaagagccgctgccggccaaggcgttgacgctgatgcgg
ctgtcgcccgaccggccgggggacagctgggcacagctgcccaacccgctcgtcacgcgc
gcgttctga

DBGET integrated database retrieval system