KEGG   Streptomyces avermitilis: SAVERM_2004Help
Entry
SAVERM_2004       CDS       T00126                                 

Definition
(GenBank) putative siderophore biosynthesis protein/iron transport protein
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
sma  Streptomyces avermitilis
Pathway
sma03030  DNA replication
sma03430  Mismatch repair
sma03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SAVERM_2004
   03430 Mismatch repair
    SAVERM_2004
   03440 Homologous recombination
    SAVERM_2004
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sma03032]
    SAVERM_2004
   03400 DNA repair and recombination proteins [BR:sma03400]
    SAVERM_2004
Enzymes [BR:sma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     SAVERM_2004
DNA replication proteins [BR:sma03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     SAVERM_2004
DNA repair and recombination proteins [BR:sma03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     SAVERM_2004
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IucA_IucC FhuF
Motif
Other DBs
NCBI-ProteinID: BAC69715
NITE: SAV2004
UniProt: Q82LK6
Position
2443486..2444994
Genome map
AA seq 502 aa AA seqDB search
MHRPATAESELAAELDAVRPGLSAPYAAALPGARAAVLTRLWRALAHEPLPWIAHREPEP
GGLTLRLADGRRLHGPPSDPYATAPYVTGVRLDETSYAHPARLVSALGVPHGPALAAELD
HSVASLALSRAGQPRVDPKSPTTSWEWEQRVVDGHPFHPNCRSRPGFSAAEQLAYGPEHR
PVVRLGLVAVEECLVRGEWPKWLRDGERVLIPVHPWQTAHVLDAPVEDGPAAHPLMSLRT
LALRDGGPDVKTALSARLTSSVRDISVYSIETSATVSEFAEAFAARTDGLLHITRTLGAA
TAGRPELAAVVRESPDTYADAEAAERVVPVASLTGTGLPGSPAWLAEFTRLTLTVGLRLL
DLGVALEAHGQNLLVVLSATGAPLRLVYRDLADIRVSPARLARHGVPLPDLGGRLVTDDE
TTLRRKLFGSLVAGALAATAGSGPALREALAAAARDLPRTPDLTALLEEPLPAKALTLMR
LSPDRPGDSWAQLPNPLVTRAF
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
gtgcaccgtcccgccaccgcagagtccgagctcgccgccgagctcgacgccgtacggccc
ggcctgtcggcgccgtacgcggccgcgctcccgggcgcccgtgcggccgtcctgacccgg
ctgtggcgggcgctggcccatgagccgctgccgtggatcgcgcaccgggagccggagccc
ggcggactcacgctgcggctggccgacggacgccggctgcacggcccgccctcggacccg
tacgcgaccgctccgtacgtcaccggcgtgcggctcgacgagacgtcgtacgcgcatccg
gcccggctggtgtcggcgctcggcgtcccgcacggcccggccctggccgccgaactcgac
cacagtgtcgcctcgttggccctgtcgcgggccggtcagccgcgggtcgacccgaagtcg
ccgacgacgagctgggagtgggaacagcgggtggtcgacgggcatccgttccaccccaac
tgccgttcccggcccggcttttcggccgccgagcagctcgcttacgggcccgagcaccgg
ccggtggtgcggctgggcctcgtggccgtggaggagtgtctcgtccggggcgagtggccc
aagtggctgcgggacggggagcgcgtgctgattccggtccacccctggcagacggcacac
gtgctcgacgcaccggtggaggacgggccggccgcccacccgctgatgtccttgcggacc
ctcgcgctccgcgacggcggcccggacgtcaagaccgcgctcagcgcccggctgacatcg
tccgtgcgggacatctccgtgtactcgatcgagacgtccgcgacggtgtcggagttcgcc
gaggccttcgccgcccgcacggacggcctgctgcacatcacccgcaccctgggcgcggcc
acggccggccggcccgagctggccgcggtggtacgcgagtccccggacacgtacgccgac
gcggaggcggcggaacgtgtcgttccggtggcctcgctcaccggtaccgggctgcccggc
tctcccgcgtggctcgccgagttcacccggctcacgctcaccgtgggtctgcggctgctc
gacctgggcgtggccctggaggcgcacggccagaacctcctggtggtcctgtccgccacg
ggtgccccgctgcgcctcgtgtaccgcgacctcgccgacatccgcgtcagcccggcccgg
ctggcccggcacggtgtcccgctcccggatctcggcgggcgtctcgtcacggacgacgaa
accaccctgcgccgcaaactgttcggctccctcgtcgcgggcgcgctggcggcgacggcg
gggtcggggccggcgctgcgggaggcgctcgccgccgcggcgcgggatctgccgcgcacc
cccgatctgacggcgctgctcgaagagccgctgccggccaaggcgttgacgctgatgcgg
ctgtcgcccgaccggccgggggacagctgggcacagctgcccaacccgctcgtcacgcgc
gcgttctga

KEGG   Streptomyces avermitilis: SAVERM_2147Help
Entry
SAVERM_2147       CDS       T00126                                 

Gene name
dnaQ3
Definition
(GenBank) putative DNA polymerase III epsilon subunit
  KO
K02342  DNA polymerase III subunit epsilon [EC:2.7.7.7]
Organism
sma  Streptomyces avermitilis
Pathway
sma03030  DNA replication
sma03430  Mismatch repair
sma03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SAVERM_2147 (dnaQ3)
   03430 Mismatch repair
    SAVERM_2147 (dnaQ3)
   03440 Homologous recombination
    SAVERM_2147 (dnaQ3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sma03032]
    SAVERM_2147 (dnaQ3)
   03400 DNA repair and recombination proteins [BR:sma03400]
    SAVERM_2147 (dnaQ3)
Enzymes [BR:sma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     SAVERM_2147 (dnaQ3)
DNA replication proteins [BR:sma03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     SAVERM_2147 (dnaQ3)
DNA repair and recombination proteins [BR:sma03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     SAVERM_2147 (dnaQ3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNase_T DUF5051 RNase_H_2
Motif
Other DBs
NCBI-ProteinID: BAC69858
NITE: SAV2147
UniProt: Q82L65
Position
complement(2613862..2614584)
Genome map
AA seq 240 aa AA seqDB search
MAWHEQLLIGFDLETTGTDPREARIVTGAVIEVKGQEPVGRREWLADPGVEIPADAVAVH
GITNERAAAEGGPPDRVAESLAQTLVGYWRTGVPVVAYNATFDLTLLSAELRRYGLPSLR
ERLDGRDPAPVIDPYTIDRWVDRYRRGKRNLEAVCTEYGVPLDAAHDATADALAAARLAA
AIAHRHPKIAALGPAELHRRQIEWYAAWAADFQSFLRRKGDTAAVVDGTWPLREPADETV
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggcctggcacgagcagctgctgatcggcttcgacctggagacgaccggaacggatccg
cgcgaggcgcgcatcgtcaccggcgcggtcatagaggtcaagggtcaagagccggtcgga
cgccgcgagtggctggccgacccgggcgtggagatcccggcggacgcggtggccgtgcac
gggatcaccaatgagcgggccgcggccgagggcggtccccccgaccgggtcgccgagtcc
ctggcgcagaccctcgtggggtactggcgaaccggagtgccggtcgtggcgtacaacgcg
accttcgacctcaccctcctgtccgccgaactgcgccggtacggactgccgtcgctgcgc
gagcggctcgacggccgcgacccggcaccggtgatcgacccgtacacgatcgaccgctgg
gtggaccgctaccgccgcggcaagcggaacctcgaggcggtctgcacggagtacggcgtc
cccctggacgccgcgcacgacgcgaccgcggacgccctggccgcggcccggctcgccgcc
gcgatagcccaccgccacccgaagatcgccgcgctcggcccggcggagctgcaccgccgc
cagatcgagtggtacgcggcctgggcggcggacttccagagcttcctgcgccgcaagggc
gacacggcggcggtcgtggacggcacatggccgctgcgggagccggcggacgaaacggtc
tga

KEGG   Streptomyces avermitilis: SAVERM_3362Help
Entry
SAVERM_3362       CDS       T00126                                 

Gene name
dnaN2
Definition
(GenBank) putative DNA polymerase III beta subunit
  KO
K02338  DNA polymerase III subunit beta [EC:2.7.7.7]
Organism
sma  Streptomyces avermitilis
Pathway
sma03030  DNA replication
sma03430  Mismatch repair
sma03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SAVERM_3362 (dnaN2)
   03430 Mismatch repair
    SAVERM_3362 (dnaN2)
   03440 Homologous recombination
    SAVERM_3362 (dnaN2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sma03032]
    SAVERM_3362 (dnaN2)
   03400 DNA repair and recombination proteins [BR:sma03400]
    SAVERM_3362 (dnaN2)
Enzymes [BR:sma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     SAVERM_3362 (dnaN2)
DNA replication proteins [BR:sma03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     SAVERM_3362 (dnaN2)
DNA repair and recombination proteins [BR:sma03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     SAVERM_3362 (dnaN2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_beta DNA_pol3_beta_2 DNA_pol3_beta_3
Motif
Other DBs
NCBI-ProteinID: BAC71073
NITE: SAV3362
UniProt: Q82HZ6
Position
4177745..4178875
Genome map
AA seq 376 aa AA seqDB search
MEFQVERGAFAEAVGWAARALPARSPVPVLGGLLLTADAGRLSVSGFDFEAAARIGTDAE
TVAEGQVLVLGRRLLDICRVLPDGPVSCVLEGTRFTVEAGGTRFGLSTLPREEYPALPVP
PEPYGSVDADAFASAVSQVAVAAGRDDTLPVLTGVQLRLDGDAMTLAASDRYRYAVRTLG
WQPEAAADGVVEALLPARRLLDIARSLARSGDVRIGFDRAAGGLIGFEGGRMRTVVRLLE
GRLPKYGSLFAVAGAAVAEVECGALAEAVRRVAVVAEANSPVRLDFSAPDGTVLLGAGYG
DDVAAQRLPAVLSGAEEVTAAFNPGYLLDALNSFEAPRVRLELLGAGQRTLLTAVADGGE
PDTAHRHLLMSVRQLV
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggagttccaggtcgaacgcggggcgttcgccgaggcggtgggctgggcggcccgcgca
ctgcccgcgcgttcgccggtgccggtactgggcgggctgctgctgacggcggacgcgggg
cggctgagcgtctcggggttcgacttcgaggcggccgcgcgcatcgggaccgacgcggag
acagtggcggaagggcaggtgctcgtcctcgggcgcaggctgctggacatctgccgggtg
ctgccggacggtccggtgagctgtgtgctggaggggacgcggttcacggtggaggcgggc
ggcacccggttcggcctgtcgacgctgccgcgcgaggagtacccggcgctgcccgtaccg
cccgagccgtacggcagcgtggacgccgacgcgttcgcgagcgccgtctcccaggtcgcc
gtcgccgccggacgcgacgacaccctgccggtgctcaccggcgtacagctgcgcctggac
ggcgacgcgatgacgctggccgcgtcggaccgctaccgctatgccgtgcggacgctgggg
tggcagccggaggcggcggccgacggagtcgtggaggcgctgctgcccgcgcggcggctg
ctcgacatcgcgcgctcactggcccgctccggtgacgtccgcatcggcttcgaccgggcg
gccggcgggctgatcggcttcgagggcggtcggatgcgtacggtcgtacggctgctggag
gggcggctgccgaagtacgggtcgctgttcgccgtggcgggggccgcggtcgccgaggtc
gagtgcggggcgctggcggaggcggtacggcgggtcgcggtggtggcggaggcgaacagt
ccggtgcggctggacttctcggcgccggacgggacggtgctgctgggcgccgggtacggc
gacgacgtggccgcgcagcggctgcccgccgtgctgagcggtgccgaagaggtcacggcg
gcgttcaacccggggtatctgctggacgcgctgaactccttcgaggcgccccgggtgcgg
ctggagctgctgggggccggacagcggacgctgctcacggcggtggcggacggcggcgag
ccggacaccgcgcaccggcatctgctcatgtccgtgaggcaactggtctga

KEGG   Streptomyces avermitilis: SAVERM_4150Help
Entry
SAVERM_4150       CDS       T00126                                 

Gene name
dnaZX
Definition
(GenBank) putative DNA polymerase III gamma and tau subunit
  KO
K02343  DNA polymerase III subunit gamma/tau [EC:2.7.7.7]
Organism
sma  Streptomyces avermitilis
Pathway
sma03030  DNA replication
sma03430  Mismatch repair
sma03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SAVERM_4150 (dnaZX)
   03430 Mismatch repair
    SAVERM_4150 (dnaZX)
   03440 Homologous recombination
    SAVERM_4150 (dnaZX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sma03032]
    SAVERM_4150 (dnaZX)
   03400 DNA repair and recombination proteins [BR:sma03400]
    SAVERM_4150 (dnaZX)
Enzymes [BR:sma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     SAVERM_4150 (dnaZX)
DNA replication proteins [BR:sma03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     SAVERM_4150 (dnaZX)
DNA repair and recombination proteins [BR:sma03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     SAVERM_4150 (dnaZX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_delta2 DNA_pol3_gamma3 AAA RuvB_N Rad17 AAA_30 AAA_22 AAA_16 AAA_14 AAA_5 zf-CXXC Mg_chelatase T2SSE TsaE AAA_19 AAA_18
Motif
Other DBs
NCBI-ProteinID: BAC71862
NITE: SAV4150
UniProt: Q82FV2
Position
complement(5092430..5094970)
Genome map
AA seq 846 aa AA seqDB search
MSSLALYRRYRPESFAEVIGQEHVTDPLQQALRNNRVNHAYLFSGPRGCGKTTSARILAR
CLNCEQGPTPTPCGACQSCQDLARNGPGSIDVIEIDAASHGGVDDARDLREKAFFGPAGS
RYKIYIIDEAHMVTSAGFNALLKVVEEPPEHLKFIFATTEPEKVIGTIRSRTHHYPFRLV
PPGTLREYLGDVCGRENIPVADGVLPLVVRAGGGSVRDSMSVMDQLLAGAGADGVTYAMA
TSLLGFTDGSLLDSVVEAFASGDGAAAFEVVDRIIEGGNDPRRFVADLLERLRDLVILAA
VPDAGEKGLIDAPADVVERMQAQAGVFGAAELSRAADLVNEGLTEMRGATSPRLQLELIC
ARVLLPAAYGDDRSLMARLDRLERGVNFSGGGAGPAMGYVPGPGAHGGASVPQMSQPAQT
PQVPQMPQMSQGSYAQQAPQVPPGGGVDAARAAVRGGPGGAGGPAAGQGVPGAEAAYGDV
DAGVAGSGAASAPVQEAPAEAAPPASQPTAEQPQPQPPAQPQPHTQPQAPAAAPAPAPGA
WPTASAAGSGRRPGGWPTATPAGGGQPQTPAAAASAAPPASGPAPASAPAPSAPAPAPAA
AYAPAAGGPDPRMLWPNILEAVKNRRRFTWILLSQNAQVTGFDGTTLQIGFVNAGARDNF
ASSGSEDVLRQALAEQFNVQWKIEAVVDPSGGSAQAAGGGSGPRVRRRRCRVQRGRRLRL
RRRVRRSSGRPAPRAAAVRPTGAGPRRVGGSGPVRQTDCARPGIHTTARSATAHRPRGRH
GGGRRPRPRRVRPLGPRTDRPGARGDGDGGVLPRVRAPAAARRGGVWLAASRMSHSPRPF
LARPFD
NT seq 2541 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgtctctcgcgctgtaccgccgctatcgcccggagtcgttcgccgaggtcatcggg
caggagcatgtcaccgacccgctgcagcaggcgctgcggaacaaccgggtcaatcacgcg
tacctgttcagcggtccgcgcggatgcgggaagaccaccagcgcacgcatcctggccagg
tgcctgaactgcgagcaggggcccacgcccaccccctgcggcgcatgccagtcctgccag
gacctcgcgaggaacgggccgggatcgatcgacgtcatcgagatcgacgccgcttcgcac
ggtggtgtggacgacgcgcgtgacctgcgggaaaaggccttcttcggaccggcgggcagc
cggtacaagatctacatcatcgacgaggcccacatggtcacgtcggccggtttcaacgcg
ctcctcaaggtcgtcgaggagccgccggagcatctgaagttcatcttcgcgaccaccgag
cccgagaaggtcatcggaaccatccgttcgcggacccatcactatcccttccggctcgtg
ccgcccgggacccttcgggagtacctcggcgacgtgtgcgggcgggagaacatccccgtc
gcggacggggtgctgccgctcgtggtgcgcgccggcggcggttccgtacgtgactccatg
tccgtcatggaccagctgctcgcgggagcgggcgccgacggtgtgacgtacgccatggcc
acctcgctcctcgggttcacggacgggtcgctgctcgactcggtggtcgaggcgttcgcg
tcgggcgacggagccgcggccttcgaggtcgtggaccggatcatcgaggggggcaacgat
ccgcggcggttcgtcgccgacctgctggagcggctgcgggacctggtgatcctggccgcc
gtgcccgacgcgggcgagaaggggctcatcgacgctcccgccgatgtcgtggagcggatg
caggcccaggccggggtcttcggcgccgccgaactcagccgggccgccgacctcgtcaat
gaggggctgacggagatgcggggcgccacttcgccccggctccagctcgaactcatctgc
gcgcgcgtgctgctgccggcggcgtacggcgacgaccgttcgctcatggcccggctggac
cggctggagcgcggcgtcaacttctccggcgggggtgcggggccggccatggggtacgtg
cccgggcccggcgcgcacggcggggcttcggtgcctcagatgtctcagccggcccagacg
cctcaggtgccgcagatgcctcagatgtcccaggggtcttacgcccagcaggccccccag
gtgccgccggggggcggagtcgatgcggctcgggccgcggtgcggggcgggcccggtggg
gcgggcggtcctgccgccgggcagggcgtaccgggtgcggaggccgcgtacggggatgtc
gacgccggggtggccggctcgggcgcggcttcggcgcccgtccaggaggcgcccgcggag
gctgcgccgcccgcttcccagccgaccgctgagcagccccagccccagccaccggcacag
ccacaacctcatacccagccgcaggctcccgccgccgcgcccgcgcccgcaccgggagcc
tggcccaccgcgagcgccgcgggcagcggccggcgtccgggtggctggccgacggccacg
cccgcgggcgggggacagccgcagactccggccgccgctgcctctgccgctccccccgct
tccggccctgccccggcttccgctccggcgccctcagccccggcgcccgctcccgccgcg
gcctacgccccggctgccggtgggcccgacccccgcatgctctggccgaacatcctggag
gcggtgaagaaccggcgccgcttcacctggatcctgctcagccagaacgcgcaggtcacg
ggtttcgacggcacgacgctccagatcggcttcgtcaacgcgggcgcgcgggacaacttc
gcgagcagcggcagcgaggacgtactgcggcaggcgctggccgagcagttcaacgtgcag
tggaagatcgaggcggtcgtcgacccgtcgggcggttcggcccaagcggcgggcgggggc
tccggcccccgggttcggcggcggcggtgccgggttcaacgcgggcggcggctccggctt
cggcggcgggtacggcggagctccggccgccccgcgccccgcgccgcagcagtccgcccc
accggcgccgggccccgccgcgtcggtggctccggccccgtccgccagacagactgcgcc
cgccccggcatccacaccaccgcccgctccgccacggcacatcgcccccgaggacgacat
gggggaggacgacgaccccgacctcgacgagtccgccctctcgggccacgaactgatcgt
ccgggagctcggggcgacggtgatggaggagttctcccacgagtaagggcgccggcagcg
gcccggcgaggaggggtgtggctcgcggcgtcgcggatgtcccacagcccccgcccgttc
ctcgcccgacccttcgactag

KEGG   Streptomyces avermitilis: SAVERM_4317Help
Entry
SAVERM_4317       CDS       T00126                                 

Gene name
dnaN1
Definition
(GenBank) putative DNA polymerase III beta subunit
  KO
K02338  DNA polymerase III subunit beta [EC:2.7.7.7]
Organism
sma  Streptomyces avermitilis
Pathway
sma03030  DNA replication
sma03430  Mismatch repair
sma03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SAVERM_4317 (dnaN1)
   03430 Mismatch repair
    SAVERM_4317 (dnaN1)
   03440 Homologous recombination
    SAVERM_4317 (dnaN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sma03032]
    SAVERM_4317 (dnaN1)
   03400 DNA repair and recombination proteins [BR:sma03400]
    SAVERM_4317 (dnaN1)
Enzymes [BR:sma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     SAVERM_4317 (dnaN1)
DNA replication proteins [BR:sma03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     SAVERM_4317 (dnaN1)
DNA repair and recombination proteins [BR:sma03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     SAVERM_4317 (dnaN1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_beta DNA_pol3_beta_3 DNA_pol3_beta_2
Motif
Other DBs
NCBI-ProteinID: BAC72029
NITE: SAV4317
UniProt: Q82FD7
Position
5289024..5290154
Genome map
AA seq 376 aa AA seqDB search
MKIRVERDVLAEAVAWAARSLPARPPAPVLAGLLLRAEDGALSLSSFDYEVSARVSVEAE
VEEDGTVLVSGRLLADICRALPNRPVEISTDGVRATVVCGSSRFTLHTLPVEEYPALPQM
PNATGTVPGEVFASAAAQVAIAAGRDDTLPVLTGVRIEIEGDTVTLASTDRYRFAVREFL
WKPENPDASAVALVPAKTLLDTAKALTSGDSVTLALSGSGSGEGLIGFEGAGRRTTTRLL
EGDLPKYRTLFPTEFNSIAVIETAPFVEAVKRVALVAERNTPVRLSFEQGVLILEAGSSD
DAQAVERVDAQLDGDDISIAFNPTFLLDGLSAIDSPVAQLSFTTSTKPALLSGKPAVDAE
ADEAYKYLIMPVRLSG
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
gtgaagatccgggtggaacgcgacgtactcgcggaggcagtggcctgggcggctcgcagc
ctcccggcacgaccgccggcgcctgtcctcgccggcctcctgctgagggccgaggacggg
gctctcagcctctccagcttcgactacgaggtctccgcacgcgtgtcggtggaggcggag
gtcgaggaggacggcacggtcctcgtgtcgggccgtctgctcgccgacatctgtcgcgcc
ctccccaaccggccggtggagatttccacagacggtgtacgggcgacggtggtctgcggc
tcctcccgcttcaccctccacaccctgccggtggaggagtacccggcgctcccgcagatg
ccgaacgccacgggcaccgtccccggtgaggtcttcgcgtccgccgccgcccaggtggcc
atcgccgccgggcgcgacgacacgctgcccgtcctcaccggtgtgcgcatcgagatcgag
ggcgacacggtcaccctggcgtccaccgaccgctaccgcttcgcggtccgcgagttcctg
tggaagccggagaacccggatgcgtccgcggtcgccctggtgcccgccaagaccctcctg
gacaccgccaaggcgctcaccagcggcgacagcgtcaccctggcgctgtccggctcgggg
tcgggcgagggcctgatcggcttcgagggcgcggggcggcgtacgaccacgcgtctgctg
gagggtgacctcccgaagtaccgcacgctgttcccgacggagttcaactccatcgccgtc
atcgagaccgcccccttcgtggaggccgtcaagcgcgtggccctcgtcgccgagcgcaac
accccggtgcggctcagcttcgagcagggcgtgctcatcctggaggcgggctccagcgac
gacgcacaggctgtggaaagggtcgacgcgcagctggacggcgacgacatctccatcgcc
ttcaacccgaccttcctgctggacggcctgagcgccatcgactccccggtggcacagctc
tccttcacgacgtccacgaagcccgctctgctgtccggcaagccggccgtggacgccgag
gcggacgaggcctacaagtacctgatcatgccggtgcgcctcagcggctga

KEGG   Streptomyces avermitilis: SAVERM_4623Help
Entry
SAVERM_4623       CDS       T00126                                 

Gene name
holB
Definition
(GenBank) putative DNA polymerase III delta prime subunit
  KO
K02341  DNA polymerase III subunit delta' [EC:2.7.7.7]
Organism
sma  Streptomyces avermitilis
Pathway
sma03030  DNA replication
sma03430  Mismatch repair
sma03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SAVERM_4623 (holB)
   03430 Mismatch repair
    SAVERM_4623 (holB)
   03440 Homologous recombination
    SAVERM_4623 (holB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sma03032]
    SAVERM_4623 (holB)
   03400 DNA repair and recombination proteins [BR:sma03400]
    SAVERM_4623 (holB)
Enzymes [BR:sma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     SAVERM_4623 (holB)
DNA replication proteins [BR:sma03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     SAVERM_4623 (holB)
DNA repair and recombination proteins [BR:sma03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     SAVERM_4623 (holB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_delta2 AAA DNApol3-delta_C AAA_22 RuvB_N Mg_chelatase AAA_5 AAA_16
Motif
Other DBs
NCBI-ProteinID: BAC72335
NITE: SAV4623
UniProt: Q82EJ2
Position
5647265..5648470
Genome map
AA seq 401 aa AA seqDB search
MPVWDDLVGQEKLSEQLAAAARDADALVTAATAGTPPPEASKMTHAWLFTGPPGAGRTTA
ARAFAAALQCVSPDRALGGIPGCGFCDGCHTALLGTHADVSTVAAVGTQILADDMRDTVR
KSFTSPANGRWQVILVEDAERLNEKSANAVLKAVEEPAPRTVWLLCAPSVEDVLPTIRSR
CRHLNLLTPSVDAVADMLVRRDGIEPEAAYAAARATQGHVDRARRLATDPRARERRAAVL
KMPLRVEDIGGCLKAAQELVDAATADSKQLAEEVDVKETEEMRAALGGAQGGRMPRGTAG
VMKDLEDKQKRRRTRTQRDSLDLALTELTGFYRDVLALQLGSRLALANTDAEDALERLAR
GSSPEATLRRIDAIAACRDALDRNVAPLLAVEAMTMALRAG
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtgtgggacgacctggtgggccaggagaagctgagcgagcagctcgccgcggct
gcccgtgacgccgacgccctggtcaccgcggccaccgccggcactccgccgcccgaggcg
tcgaagatgacgcacgcctggctgttcacgggcccgcccggcgcgggccgcaccacggcc
gcgcgtgccttcgccgcggcgctccagtgcgtgagccccgaccgcgcgctgggcggcatc
cccggctgcggcttctgcgacggctgccatacggccctgctcggcacccacgccgacgtc
agcacggtcgccgccgtgggcacgcagatcctcgccgacgacatgcgggacaccgtgcgc
aagtcgttcacgtctccggccaacggacgctggcaggtgatcctcgtggaggacgccgag
cggctgaacgagaagtcggccaacgcggtcctgaaggcagtggaggagcccgccccccgc
acggtctggctgctgtgcgccccctccgtggaggacgtcctgccgacgatccgctcccgc
tgccgccacctgaacctgctcacaccttccgtggacgccgtcgcggacatgctcgtacgc
cgggacggcatcgagccggaggccgcgtacgccgcggcccgcgccacgcagggccatgtc
gaccgtgcccgccgcctggccaccgacccgcgcgcgcgggagcgcagggccgccgtgctg
aaaatgccgttgcgggtcgaggacatcggcggctgcctcaaggcggcccaggagctggtc
gacgccgccacggccgactccaagcagctcgccgaggaagtcgacgtgaaggagaccgag
gagatgagggcggcgctcggcggggcacagggcggtcggatgccgcgcggcaccgcgggc
gtgatgaaggacctggaagacaagcagaagcgccggagaacgcgtacgcagcgcgacagc
ctggacctggccctgaccgagctgacgggcttctatcgcgacgtcctcgccctccagctc
ggctcccgcctggccctcgccaacacggacgccgaggacgccctggagcgcctcgcccgc
ggcagctcaccggaggccacactccgccgcatcgacgcgatcgccgcgtgccgggacgcc
ctggaccgcaatgtggcccctctgctggcggtggaggcgatgacgatggcactgcgggcg
gggtga

KEGG   Streptomyces avermitilis: SAVERM_5558Help
Entry
SAVERM_5558       CDS       T00126                                 

Gene name
holA
Definition
(GenBank) putative DNA polymerase III delta subunit
  KO
K02340  DNA polymerase III subunit delta [EC:2.7.7.7]
Organism
sma  Streptomyces avermitilis
Pathway
sma03030  DNA replication
sma03430  Mismatch repair
sma03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SAVERM_5558 (holA)
   03430 Mismatch repair
    SAVERM_5558 (holA)
   03440 Homologous recombination
    SAVERM_5558 (holA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sma03032]
    SAVERM_5558 (holA)
   03400 DNA repair and recombination proteins [BR:sma03400]
    SAVERM_5558 (holA)
Enzymes [BR:sma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     SAVERM_5558 (holA)
DNA replication proteins [BR:sma03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     SAVERM_5558 (holA)
DNA repair and recombination proteins [BR:sma03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     SAVERM_5558 (holA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_delta HTH_29
Motif
Other DBs
NCBI-ProteinID: BAC73270
NITE: SAV5558
UniProt: Q82BZ6
Position
6723063..6724073
Genome map
AA seq 336 aa AA seqDB search
MARGMLGAMAKKTAHDDPLAPVTLAVGQEDLLLDRAVQEVVAAARAADADTDVRDLTSDQ
LQPGTLAELTSPSLFAERKVVVVRNAQDLSADTIKDVKSYLGAPAEEITLVLLHAGGAKG
KGLLDAARKAGAREVACPKMTKPADRLAFVRGEFRALGRSATSEAGQALVDSIGSDLREL
ASAVSQLTADVEGTIDEAVVGRYYTGRAEASSFTVADRAVEGRAAEALEALRWSLSTGVA
PVMITSALAQGVRAIGKLSSARGGRPADLARELGMSPWKIDRVRQQMRGWTPDGVAVALR
AVAEADAGVKGGGDDPEYALEKAVVAIAGAARSRRG
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcgtgggatgcttggcgcgatggccaagaagaccgcacatgacgaccctctcgcc
cccgtcacgcttgccgtgggccaggaggacctcctgctcgaccgtgccgtacaggaggtg
gtggccgccgcccgggccgccgacgccgacacggacgtacgtgacctgacctcggaccag
ttgcagcccggcacgctcgccgagctgaccagtccgtcgctcttcgccgagcgcaaggtc
gtggtcgtacgcaacgcgcaggatctctcggccgacacgatcaaggacgtgaagtcgtac
ctgggggcgcccgcggaggagatcaccctcgtgctgctgcatgcgggcggcgccaagggc
aagggcctgctggatgccgcgcgcaaggcgggggcgcgggaggtcgcgtgccccaagatg
acgaagccggcggaccggctggcctttgtgcgcggggagttccgggcgttggggaggtcc
gcgacgtccgaggcgggccaggcacttgtcgactccatcgggagtgatctgcgggagctg
gcgtcggcggtgtcccagctgacggcggacgtcgaggggacgatcgacgaggcggtggtc
gggcggtactacacggggcgggccgaggcgtcgagcttcacggtggcggaccgggcggtc
gaggggagggcggcggaggcgttggaggcgttgcgctggtcgctgtccaccggggttgcg
ccggtcatgatcaccagcgcgttggcgcagggtgtgcgggccattgggaagctgtcgtcc
gctcggggtgggcggccggccgatctggcgcgtgagctggggatgtcgccgtggaagatc
gatcgggttcggcagcagatgcgggggtggacgccggacggggtggctgtggcgctgcgg
gcggtcgcggaggccgacgccggagtgaagggcggcggggatgatcccgagtacgccctg
gagaaggcggtcgtggccattgctggggcggcgcggtctcgacgcgggtag

KEGG   Streptomyces avermitilis: SAVERM_6143Help
Entry
SAVERM_6143       CDS       T00126                                 

Gene name
dnaE1
Definition
(GenBank) putative DNA polymerase III alpha subunit
  KO
K02337  DNA polymerase III subunit alpha [EC:2.7.7.7]
Organism
sma  Streptomyces avermitilis
Pathway
sma03030  DNA replication
sma03430  Mismatch repair
sma03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SAVERM_6143 (dnaE1)
   03430 Mismatch repair
    SAVERM_6143 (dnaE1)
   03440 Homologous recombination
    SAVERM_6143 (dnaE1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sma03032]
    SAVERM_6143 (dnaE1)
   03400 DNA repair and recombination proteins [BR:sma03400]
    SAVERM_6143 (dnaE1)
Enzymes [BR:sma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     SAVERM_6143 (dnaE1)
DNA replication proteins [BR:sma03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     SAVERM_6143 (dnaE1)
DNA repair and recombination proteins [BR:sma03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     SAVERM_6143 (dnaE1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_alpha DNA_pol3_finger PHP HHH_6 tRNA_anti-codon
Motif
Other DBs
NCBI-ProteinID: BAC73854
NITE: SAV6143
UniProt: Q82AB6
Position
7388156..7391695
Genome map
AA seq 1179 aa AA seqDB search
MSKPPFTHLHVHTQYSLLDGAARLKDMFNACNEMGMTHIAMSDHGNLHGAYDFFHTAKKA
GVTPIIGIEAYVAPESRRNKRKIQWGQPHQKRDDVSGSGGYTHKTIWAANRTGLHNLFKL
SSDAYAEGWLQKWPRMDKETISQWSEGLIASTGCPSGELQTRLRLGQFDEALKSAAEYQE
IFGKDRYFLELMDHGIEIERRVRDGLLEIGKKLGIPPLVTNDSHYTYANEATAHDALLCI
QTGKNLSDPDRFRFDGTGYYLKSTDEMYAIDSSDAWQEGCANTLLVAEQIDTSGMFEAKN
LMPKFDIPEGFTEVTWFQEEVRRGMERRFPGGVPDDRQKQAEYEMDVIIQMGFPGYFLVV
ADFIMWAKKQGIAVGPGRGSAAGSIVAYAMGITDLDPIPHGLIFERFLNPERVSMPDVDI
DFDERRRVEVIRYVTEKYGADKVAMIGTYGKIKAKNAIKDSARVLGYPYAMGDRLTKAMP
ADVLGKGIDLNGITDPSHPRYSEAGEIRAMYENEPDVKKVIDTAKGVEGLVRQMGVHAAG
VIMSSEPIVDHAPIWVRHTDGVTITQWDYPQCESLGLLKMDFLGLRNLTIMDDAVKMVKS
NKGIDLDLLSLPLDDPKTFELLQRGETLGVFQFDGGPMRSLLRLMKPDNFEDISAVSALY
RPGPMGMDSHTNYALRKNGLQEITPIHKELEEPLQEVLAVTYGLIVYQEQVQKAAQIIAG
YSLGEADILRRVMGKKKPDELAKNFVLFQEGAQKKGYSDEAIQALWDVLVPFAGYAFNKA
HSAAYGLVSYWTAYLKANYPAEYMAGLLTSVKDDKDKSAVYLNECRRMGIKVLPPDVNES
MSNFAAQGDDVILFGLSAVRNVGTNVVESIIKSRKAKGKYASFPDYLDKVEAVACNKRTT
ESLIKAGAFDTMGHTRKGLTAQFEPMIDNVVQVKRKEAEGQFDLFGGMGEEESDEPGFGL
DVVFTDDEWEKTYLLAQEREMLGLYVSDHPLFGLEHVLSDKADAGIAQLTGGEHADGAVV
TIGGIISGLQRKMTKQGNAWAIATVEDLAGSLECMFFPATYQLVSTQLVEDAVVFVKGRL
DKREDVPRLVAMELQVPDLSNAGTNAPVILTIPALKVTPPMVSRLGEILSHHKGESEVRI
RLQGPRKTTVLRLDRHRVKPDPALFGDLKVLLGPSCLAG
NT seq 3540 nt NT seq  +upstreamnt  +downstreamnt
gtgtcaaagccgccgttcacgcacctgcacgtccacacccagtactcgctgctggacggt
gccgcgcggctcaaggacatgttcaatgcctgcaatgagatgggcatgacacacatcgcc
atgagcgaccacggcaacctccacggggcgtacgacttcttccacacggccaagaaggcg
ggcgtcacgccgatcatcggcatcgaggcgtacgtcgcccccgagtcccggcgcaacaag
cgcaagatccagtggggccagccgcaccagaagcgcgacgacgtgtccggttcgggtggt
tacacgcacaagacgatctgggcggcgaaccggacgggcctgcacaacctcttcaagctc
tcctcggacgcgtacgccgagggctggctccagaagtggccccggatggacaaggagacc
atctcccagtggtccgaaggtctcatcgcctccaccggctgcccctccggcgagctccag
acccggctgcgcctgggccagttcgacgaggccctgaagtcggccgccgagtaccaggag
atcttcggcaaggaccggtacttcctggagctgatggaccacggcatcgagatcgagcgc
cgggtccgtgacggtctcctggagatcggcaagaagctcggcatcccgcccctggtgacg
aacgactcgcactacacctacgcgaacgaggcgaccgcgcacgacgccctgctgtgcatc
cagaccggcaagaacctctccgacccggaccgcttccgcttcgacggcacgggctactac
ctgaagtccacggacgagatgtacgccatcgactcctcggacgcctggcaggagggctgc
gccaacacgctcctggtcgccgagcagatcgacacctccggcatgttcgaggcgaagaac
ctcatgccgaagttcgacatccccgagggcttcaccgaggtcacctggttccaggaggag
gtgcgccgcggcatggagcgccgcttccccggcggcgtccccgacgaccgtcagaagcag
gccgagtacgagatggacgtcatcatccagatggggttcccggggtacttcctcgtggtc
gccgacttcatcatgtgggccaagaagcagggcatcgcggtgggcccgggccgtggttcg
gcggccggctcgatcgtcgcgtacgccatgggcatcaccgacctcgacccgatcccgcac
ggtctgatcttcgagcggttcctcaaccccgagcgcgtctccatgcccgacgtcgacatc
gacttcgacgagcgtcggcgcgtcgaggtgatcaggtacgtgaccgagaagtacggcgcc
gacaaggtcgccatgatcggcacgtacggcaagatcaaggcgaagaacgccatcaaggac
tccgcgcgcgtgctgggctacccgtacgcgatgggcgaccgcctcaccaaggcgatgccc
gccgacgtcctcggcaagggcatcgacctcaacggcatcaccgacccctcgcacccccgc
tacagcgaggccggcgagatccgggcgatgtacgagaacgagccggacgtgaagaaggtc
atcgacaccgccaagggcgtcgagggcctggtccggcagatgggcgtgcacgccgccggc
gtcatcatgtccagcgagcccatcgtcgaccacgcccccatctgggtgcggcacacggac
ggcgtgaccatcacgcagtgggactacccgcagtgcgagtcgctcggcctgctgaagatg
gacttcctcggcctgcgcaacctgacgatcatggacgacgccgtcaagatggtgaagtcc
aacaagggcatcgacctcgacctgctgagcctcccgctcgacgacccgaagaccttcgaa
ctgctccagcgcggcgagaccctcggcgtcttccagttcgacggcggccccatgcgctcg
ctgctgcgcctgatgaagcccgacaacttcgaagacatctccgccgtctcggcgctctac
cgtcccggcccgatgggcatggactcgcacacgaactacgcgctccgcaagaacggcctt
caggagatcacgccgatccacaaggagctggaggagcccctccaggaggtcctggccgtc
acctacggcctgatcgtctaccaggagcaggtgcagaaggccgcccagatcatcgccggg
tactcgctcggcgaggccgacatcctgcgccgcgtgatgggcaagaagaagcccgacgag
ctggcgaagaacttcgtcctcttccaggagggcgcccagaagaagggctacagcgacgag
gccatccaggccctgtgggacgtcctggtgcccttcgccggatacgcgttcaacaaggcg
cactcggccgcgtacggcctggtctcgtactggaccgcgtatctgaaggcgaactacccg
gccgagtacatggccggcctgctcacctcggtcaaggacgacaaggacaagtcggccgtc
tatctgaacgagtgccggcgcatgggcatcaaggtgctcccgccggacgtcaacgagtcg
atgtcgaacttcgccgcgcagggcgacgacgtgatcctcttcggcctgtccgccgtccgt
aacgtcggtacgaacgtcgtcgagtcgatcatcaagagccgcaaggccaagggcaagtac
gcctccttccccgactatctcgacaaggtcgaggcggtcgcctgcaacaagcgcaccacc
gaatcgctgatcaaggcgggcgcgttcgacacgatggggcacacccgcaagggcctcacc
gcgcagttcgagccgatgatcgacaacgtggtgcaggtcaagcgcaaggaggccgagggc
cagttcgacctcttcggcggcatgggcgaggaggagagcgacgagcccggcttcggactc
gacgtcgtcttcaccgacgacgagtgggagaagacctatctgctcgcccaggagcgggag
atgctcggtctgtacgtctccgaccacccgctcttcggcttggagcacgtgctgtccgac
aaggccgacgcgggcatcgcccagctcaccggaggcgagcacgcggacggcgcggtcgtc
accatcggcggcatcatctcgggcctccagcgcaagatgaccaagcagggcaacgcgtgg
gcaatcgccaccgtggaggacctggcgggctccctggagtgcatgttcttcccggccacg
taccagctggtgtcgacccaactcgtcgaggacgcggtcgtgttcgtcaagggacgcctc
gacaagcgcgaggacgtgccccggctcgtcgccatggagctccaggtccccgacctgtcg
aacgcgggcaccaacgcgcccgtgatcctcaccattccggcgctgaaggtcaccccgccg
atggtgagccggctcggtgagatcctcagccaccacaagggcgagagcgaggtgcggatc
agactccagggtccgcgcaagacgaccgtgctgcggctcgaccggcaccgggtgaagccg
gatccggccctgttcggcgatctgaaggtgctgctcggcccgtcctgcctggcgggctga

KEGG   Streptomyces avermitilis: SAVERM_6439Help
Entry
SAVERM_6439       CDS       T00126                                 

Gene name
dnaQ1
Definition
(GenBank) putative DNA polymerase III epsilon subunit
  KO
K02342  DNA polymerase III subunit epsilon [EC:2.7.7.7]
Organism
sma  Streptomyces avermitilis
Pathway
sma03030  DNA replication
sma03430  Mismatch repair
sma03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SAVERM_6439 (dnaQ1)
   03430 Mismatch repair
    SAVERM_6439 (dnaQ1)
   03440 Homologous recombination
    SAVERM_6439 (dnaQ1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sma03032]
    SAVERM_6439 (dnaQ1)
   03400 DNA repair and recombination proteins [BR:sma03400]
    SAVERM_6439 (dnaQ1)
Enzymes [BR:sma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     SAVERM_6439 (dnaQ1)
DNA replication proteins [BR:sma03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     SAVERM_6439 (dnaQ1)
DNA repair and recombination proteins [BR:sma03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     SAVERM_6439 (dnaQ1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNase_T DUF5051 BRCT HisKA_3 PTCB-BRCT RNase_H_2 DNA_pol_A_exo1
Motif
Other DBs
NCBI-ProteinID: BAC74150
NITE: SAV6439
UniProt: Q829H2
Position
complement(7715780..7716757)
Genome map
AA seq 325 aa AA seqDB search
MLEDRTTAATPAPWPAAYPQGYAVVDVETTGLARDDRIISAAVYRLDARGEVEDHWYTMV
NPERDPGPVWIHGLTSDVLEGAPLFEDIAAEFASRLADRVLVAHNAVFDWSMIAREYARA
KSQAPVRQRLCTIALSKELGLPLPNHKLESLAAHFGVVQQRAHHALDDARVLAEAFRPSL
HAAARDGVRLPLLECLPLTEWNATPRIGRQPSGGYPSGSWRPSRKRPVCPYPNPGRYEEG
KPLKQGMRVAFSGDTSVDRELLEDRAVEAGLHVATSLSRLTSLLVTNDPGSGTSKTAKAR
QYGTPVIDEAAFGQLLRDVEPASQG
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgctcgaagaccgtacgaccgcagcgaccccagccccctggccggccgcgtatccacag
gggtacgcggtcgtcgacgtggagaccaccggcctggcccgggacgaccggatcatctcg
gccgccgtctaccggctggacgcgcgcggcgaggtcgaggaccactggtacacgatggtc
aacccggagcgggacccgggcccggtgtggatccacgggctgacgagcgatgtcctcgaa
ggggcaccgctcttcgaggacatcgcggcggagttcgcgtcccggctcgccgaccgcgtg
ctcgtcgcgcacaacgcggtcttcgactggtcgatgatcgcccgggagtacgcgcgcgcg
aagagccaggcgccggtgcggcagcggctgtgcaccatcgcgctctccaaggagctgggc
ctgccgctgcccaaccacaagctggagtcgctggccgcgcacttcggcgtcgtacagcag
cgggcccaccacgccctggacgacgcgcgcgtgctggccgaggcgttccggccgagtctg
cacgcggcggcgcgggacggcgtccggctgccgctgctggagtgcctgccgctcaccgag
tggaacgccaccccgcggatcggccggcagccctccggcggctatccgtccggcagttgg
cgcccctcccgcaaacgccccgtatgcccctatcccaacccgggtcgctacgaagagggc
aaaccgctcaagcaaggcatgcgggtggcgttctccggggacacctcggtcgaccgcgag
ctcctcgaggaccgcgccgtcgaggcgggcctgcatgtggcgacgagcctgtcccggctc
accagcctgctcgtcaccaacgaccccggctcgggtacgtccaagacggccaaggcgcgg
cagtacgggacaccggtgatcgacgaggcggcgttcggccagctgctgcgggacgtggag
ccggcctcgcaggggtga

DBGET integrated database retrieval system