KEGG   Streptomyces avermitilis: SAVERM_2008Help
Entry
SAVERM_2008       CDS       T00126                                 

Gene name
aspB1
Definition
(GenBank) putative aspartate aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
sma  Streptomyces avermitilis
Pathway
sma00220  Arginine biosynthesis
sma00250  Alanine, aspartate and glutamate metabolism
sma00290  Valine, leucine and isoleucine biosynthesis
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01210  2-Oxocarboxylic acid metabolism
sma01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SAVERM_2008 (aspB1)
   00290 Valine, leucine and isoleucine biosynthesis
    SAVERM_2008 (aspB1)
   00220 Arginine biosynthesis
    SAVERM_2008 (aspB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sma01007]
    SAVERM_2008 (aspB1)
Enzymes [BR:sma01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     SAVERM_2008 (aspB1)
    2.6.1.66  valine---pyruvate transaminase
     SAVERM_2008 (aspB1)
Amino acid related enzymes [BR:sma01007]
 Aminotransferase (transaminase)
  Class I
   SAVERM_2008 (aspB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 HSNSD Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: BAC69719
NITE: SAV2008
UniProt: Q82LK2
Position
2448255..2449463
Genome map
AA seq 402 aa AA seqDB search
MEFRQSSKLSEVCYEIRGPVIEHANALEEAGHSVLRLNTGNPALFGFEAPEEILQDMIRM
LPRAHGYTDSRGVLSARRAVAQRYQDRGLEVDVDDVFLGNGVSELVSMAVQALIEDGDEV
LIPAPDFPLWTAVTTLAGGKAVHYLCDEQADWYPDLADMAAKITDRTRAVVIINPNNPTG
AVYPKEIVEGILDLARRHGLMVFADEIYDQILYDDAVHHSAAALAPDLVVLTFCGLSKTY
RVAGFRSGWLVVTGPKQHARSYLEGLTMLASMRLCANAPAQYAIQAALGGRQSIQELTAP
GGRLYEQRDRAWQKLNEIPGVSCVKPKGALYAFPRIDPTVHKIHDDEKFVLDLLLREKIQ
VVQGTGFNWPRPDHFRILTLPHADDLDAAISRIGRFLSGYRQ
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggagttccggcagtcgagcaagctcagcgaggtctgttacgagatccgcggcccggtg
atcgagcacgccaacgcgctggaggaggcgggccacagcgtgctgcgcctgaacaccggc
aaccccgcgctcttcggcttcgaggcgcccgaggagatcctccaggacatgatccggatg
ctcccccgggcgcacggctacaccgactcgcgcggcgtcctctccgcccgccgcgccgtg
gcccagcgctaccaggaccgtggcctggaggtcgacgtcgacgacgtgttcctgggcaac
ggcgtctccgaactcgtctcgatggccgtacaggcgctgatcgaggacggcgacgaagtc
ctcatcccggccccggacttccccctctggacggccgtcaccacgctcgcgggcggcaag
gcggtgcactacctctgcgacgagcaggccgactggtacccggacctggcggacatggcc
gcgaagatcaccgaccgcacgcgcgccgtggtcatcatcaaccccaacaaccccaccggc
gcggtctatccgaaggagatcgtcgagggcatcctcgatctcgcccgtcggcacggcctg
atggtgttcgcggacgagatctacgaccagatcctgtacgacgacgccgtgcaccactcg
gccgccgccctcgcgcccgacctggtggtcctcaccttctgcggcctgtcgaagacgtac
cgcgtggccggcttccggtccggctggctggtcgtcacgggccccaagcagcacgcccgc
agctatctggagggcctgacgatgctcgcctccatgcggctgtgcgcgaacgcccccgcc
cagtacgcgatccaggccgcgctcggcggccgccagtccatccaggagctgaccgcaccg
ggcggccggctgtacgagcagcgcgaccgcgcctggcagaagctcaacgagatcccgggc
gtctcgtgcgtgaagccgaagggcgcgttgtacgcgttcccgcgcatcgaccccaccgtg
cacaagatccacgacgacgagaagttcgtcctggacctgctgctgcgggagaagatccag
gtggtccagggcaccggcttcaactggccccgccccgaccacttccgcatcctcacgctc
ccccacgcggacgacctggacgcggcgatcagccggatcgggcggttcctgagcgggtac
cggcagtaa

KEGG   Streptomyces avermitilis: SAVERM_3285Help
Entry
SAVERM_3285       CDS       T00126                                 

Gene name
aspB3
Definition
(GenBank) putative aspartate aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
sma  Streptomyces avermitilis
Pathway
sma00220  Arginine biosynthesis
sma00250  Alanine, aspartate and glutamate metabolism
sma00290  Valine, leucine and isoleucine biosynthesis
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01210  2-Oxocarboxylic acid metabolism
sma01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SAVERM_3285 (aspB3)
   00290 Valine, leucine and isoleucine biosynthesis
    SAVERM_3285 (aspB3)
   00220 Arginine biosynthesis
    SAVERM_3285 (aspB3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sma01007]
    SAVERM_3285 (aspB3)
Enzymes [BR:sma01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     SAVERM_3285 (aspB3)
    2.6.1.66  valine---pyruvate transaminase
     SAVERM_3285 (aspB3)
Amino acid related enzymes [BR:sma01007]
 Aminotransferase (transaminase)
  Class I
   SAVERM_3285 (aspB3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Cys_Met_Meta_PP Aminotran_3 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: BAC70996
NITE: SAV3285
UniProt: Q82I73
Position
4087192..4088403
Genome map
AA seq 403 aa AA seqDB search
MQVIQSTKLANVCYEIRGPVLEEAMRLEAAGHRILKLNTGNPAAFGFECPPEILEDILRN
VSSAHGYGDAKGLLAARRAVVMHNQTLGIETDVEHVFVGNGVSELIVMAMQGLLDDGDEV
LVPAPDYPLWTASVSLSGGTAVHYHCDEQSDWMPDLADVERKVTDRTKAIVIINPNNPTG
AVYDEAMLRGLTDIARRHNLLVCSDEIYDKILYDGATHTPTAAVAPDLLTLTFNGMSKAY
RVAGYRVGWMAISGPRAHADSYIEGLTILANMRLCANMPGQHGVVAALSGRQTINELVLP
GGRLKEQRDVAHELLTQIPGVSCVKPKGALYLFPRLDPKVFKIKDDRQMVLDLLRREKIM
VVQGTGFNWPDPDHFRVVTLPTVGDLTSAITRIGNFLDGYSQP
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtgatccagtccacgaagctcgccaacgtctgctacgagatccggggcccggtg
ctcgaggaggcgatgcggctggaagcggctggtcatcggatcctcaagctcaacacgggc
aatccggcggcgttcggcttcgagtgcccgcccgagatcctcgaggacatcctccgcaac
gtctcctccgcacacggctacggcgacgcgaagggcctgctggccgcccgccgcgccgtc
gtcatgcacaaccagaccctcggcatcgagacggacgtcgagcacgtcttcgtgggcaac
ggcgtctccgagctgatcgtgatggccatgcagggcctgctggacgacggcgacgaggtg
ctcgtaccggcgcccgactacccgctgtggaccgcctccgtctccctgtccggcggcacg
gccgtgcactaccactgcgacgagcagtcggactggatgcccgacctcgccgacgtggag
cgcaaggtcaccgaccgcaccaaggcgatcgtcatcatcaacccgaacaacccgacgggc
gcggtgtacgacgaggcgatgctgcggggcctgacggacatcgcccgccgccacaacctg
ctcgtctgctcggacgagatctacgacaagatcctctacgacggcgccacgcacaccccg
accgccgcggtcgcccccgatctgctcacgctgacgttcaacggcatgtcgaaggcgtac
cgcgtggccggctaccgggtcggctggatggcgatctccgggccgcgcgcgcacgccgac
tcgtacatcgagggcctgacgatcctggcgaacatgcggctgtgcgcgaacatgccgggt
cagcacggggtggtcgccgcgctgagcggccgtcagacgatcaacgaactggtgctgccg
ggcggacggctcaaggaacagcgggacgtggcgcacgagctgctgacccagatccccggc
gtgagctgtgtgaagccgaagggcgcgctctatctgttcccgcggctcgaccccaaggtc
ttcaagatcaaggacgaccggcagatggtgctcgacctgctgcgccgcgagaagatcatg
gtggtccagggcacgggcttcaactggccggaccccgaccacttccgggtggtgaccctg
ccgacggtgggcgatctgacctcggcgatcacccggatcgggaacttcctggacggttac
agccagccgtga

DBGET integrated database retrieval system