KEGG   Streptomyces avermitilis: SAVERM_2039
Entry
SAVERM_2039       CDS       T00126                                 

Gene name
mcmB
Definition
(GenBank) putative methylmalonyl-CoA mutase, beta subunit
  KO
K01847  methylmalonyl-CoA mutase [EC:5.4.99.2]
Organism
sma  Streptomyces avermitilis
Pathway
sma00280  Valine, leucine and isoleucine degradation
sma00630  Glyoxylate and dicarboxylate metabolism
sma00640  Propanoate metabolism
sma01100  Metabolic pathways
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
Module
sma_M00741  Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SAVERM_2039 (mcmB)
   00640 Propanoate metabolism
    SAVERM_2039 (mcmB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAVERM_2039 (mcmB)
Enzymes [BR:sma01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.2  methylmalonyl-CoA mutase
     SAVERM_2039 (mcmB)
SSDB
Motif
Pfam: MM_CoA_mutase
Other DBs
NCBI-ProteinID: BAC69750
NITE: SAV2039
UniProt: Q82LH1
Position
2485130..2486941
AA seq 603 aa
MTVLPDDGLSLAAEFPDATLEQWQRLVAGVLRKSGKEVSDTAAEEALSTALEDGLASRPL
YTARDSAPDPGLPGFAPFVRGGRAEGNTTGGWDVRQRHSAADGDAVLADLENGVTSLWLV
AGAGGIPVPSLGRVLDGVYLDLAPVALDAGGDTEPAARELLRLYAERGVAKEAARGNLGA
DPLGHEARTGDEPFDFAPVAGLARLCAEEYPGLRALTVDALPYHEAGGSAAQELGCSLAT
GVAYLRELTAAGLSVEHACGQLEFRYAATADQFLTIAKLRAARRLWARVAEVCGAPGAGA
QVQHAVTSPVMMARRDPWVNMLRTTVATLAAGVGGADAVTVLPFDHALGLPDAFARRIAR
NTSTILVEESHLSRVIDPAGGSWYVERLTDELAHSGWEFFQWIEREGGQAGALRSGRLGQ
DLANTWAARSAKLAERREPVTGVSEFPSLAERPVERAPAPASPSGGLPRVRRDEAYETLR
ARSDAHLAATGSRPRIFLAALGPAAAHTARLAFASNLFQAGGIEPVTEGTFEDSGATEVC
LCSSDALYEERAAEVAGAVKAAGARHVFLAGRPGRYPGVDSHVFAGCDTVAVLSATLDRM
GVS
NT seq 1812 nt   +upstreamnt  +downstreamnt
atgacggtcctgcctgacgacgggctttcgctggccgccgagttccctgatgcgaccctt
gagcagtggcagcgcctcgtggcgggcgtactgcgcaagtcgggcaaggaagtctcggac
acggcagccgaggaagctctgtccaccgcgctggaggacggcctcgccagccggcctctg
tacacggcgcgcgactccgcgcccgatcccggccttcccggtttcgcccccttcgtccgc
ggtggccgcgccgaggggaacaccaccggcggctgggacgtacggcagcggcactcggcc
gccgacggcgacgcggtgctcgcggacctggagaacggcgtcacctcactctggctggtc
gccggcgcgggcggaatccctgtgccctcgctcggccgggtcctcgacggcgtctacctc
gacctggcgcccgtcgccctcgacgcgggaggtgacaccgagcccgccgcgcgcgagttg
ctgcggctgtacgcggagcggggtgtcgccaaggaggcggcgcgcggcaatctgggtgcg
gacccgctgggccacgaggcccgtacgggagacgagccgttcgacttcgcgccggtcgcc
ggcctcgcgcggttgtgtgccgaggagtacccggggctgcgcgcactgaccgtggacgcg
ttgccctaccacgaggccggtggctccgccgctcaggagctcggctgttcgctggcgacc
ggcgtcgcctatctgcgggagctgaccgcggccggcctctcggtcgaacacgcctgcggg
cagctggagttccggtacgccgccaccgccgaccagttcctgaccatcgccaaactgcgg
gcggcccgcaggctgtgggcacgggtcgccgaggtgtgcggggcgccgggcgcgggggcg
caggtgcagcatgccgtgacctcgccggtcatgatggcgcgccgcgatccgtgggtgaac
atgctgcgtacgacggtcgccaccctggcggccggggtcggtggcgccgacgccgtcacg
gtgctgcccttcgaccacgccctcggccttcccgacgcgttcgcccggcggatcgcccgc
aacacctcgacgatcctggtcgaggagtcgcatctgtcgagggtgatcgatccggcgggc
ggctcctggtacgtggagcggctcaccgacgaactcgcccactcgggctgggagttcttc
caatggatcgagcgggagggcggccaggcgggggccctgcgctcgggccggctcgggcag
gacctggcgaacacctgggcggcgcggagcgcgaagctcgccgaacgacgtgagcccgtg
accggggtcagcgagttcccgagtctcgccgagcgccccgtggagcgcgcgcccgcaccc
gcctctccgtccggcggcctcccccgggtgcggcgcgacgaggcgtacgagacgctgcgc
gcccgctccgacgcccacctggcggcgaccgggtcccggccgcggatcttcctggccgcc
ctgggtcccgccgccgcccacaccgcccgtctcgccttcgcctcgaacctgttccaggcc
ggtggcatcgagcccgtcacggagggcacgttcgaggacagcggtgccaccgaggtctgt
ctctgctccagcgacgcgctgtacgaggagcgggccgcggaggtcgccggggccgtcaag
gcggcaggcgccaggcatgtgttcctcgccggccgtcccgggcggtaccccggtgtcgac
agccatgtcttcgcgggctgtgacaccgtcgccgtactctccgccaccctcgaccgtatg
ggagtgtcctga

KEGG   Streptomyces avermitilis: SAVERM_2040
Entry
SAVERM_2040       CDS       T00126                                 

Gene name
meaA2
Definition
(GenBank) putative methylmalonyl-CoA mutase, coenzyme B12-dependent alpha subunit
  KO
K01847  methylmalonyl-CoA mutase [EC:5.4.99.2]
Organism
sma  Streptomyces avermitilis
Pathway
sma00280  Valine, leucine and isoleucine degradation
sma00630  Glyoxylate and dicarboxylate metabolism
sma00640  Propanoate metabolism
sma01100  Metabolic pathways
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
Module
sma_M00741  Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SAVERM_2040 (meaA2)
   00640 Propanoate metabolism
    SAVERM_2040 (meaA2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAVERM_2040 (meaA2)
Enzymes [BR:sma01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.2  methylmalonyl-CoA mutase
     SAVERM_2040 (meaA2)
SSDB
Motif
Pfam: MM_CoA_mutase B12-binding Ca_hom_mod
Other DBs
NCBI-ProteinID: BAC69751
NITE: SAV2040
UniProt: Q82LH0
Position
2486941..2489115
AA seq 724 aa
MGIPDFAGIELGTPTASGGPDEWRTALKKATGGDDLLWETPEGITVKPLYTGQDVEGLDF
LGTYPGIAPYLRGPYPTMYVNQPWTIRQYAGFSTAEESNAFYRRNLAAGQKGLSVAFDLP
THRGYDSDHPRVTGDVGMAGVAIDSIYDMRQLFDGIPLDKMTVSMTMNGAVLPVLALYIV
AAEEQGVPPEKLAGTIQNDILKEFMVRNTYIYPPKPSMRIISDIFAFTSQRMPRYNSISI
SGYHIQEAGATADLELAYTLADGVEYLRAGQEAGLDVDAFAPRLSFFWAIGMNFFMEIAK
MRAARLLWAKLVKQFDPKNAKSLSLRTHSQTSGWSLTAQDVFNNVTRTCVEAMAATQGHT
QSLHTNALDEALALPTDFSARIARNTQLLIQQESGTTRVIDPWGGSAYVEKLTYDLARRA
WQHIEEVEAAGGMAQAIDAGIPKLRVEEAAARTQARIDSGRQPVIGVNKYRVETDEKIDV
LKVDNSSVRAQQIEKLRRLRAERDEQACQDALHALTRAAEGTGNLLELAVNAARAKATVG
EISDALEKVYGRHAGQIRTISGVYRTEAGESPSVERTRTLVGSFEEAEGRRPRILVAKMG
QDGHDRGQKVIATAFADLGFDVDVGPLFQTPAEVARQAVEADVHIVGVSSLAAGHLTLVP
ALREQLAEEGREDIMIVVGGVIPPQDVPTLLEMGAAAVFPPGTVIPDAAYDLVTRLAADL
GHDL
NT seq 2175 nt   +upstreamnt  +downstreamnt
atgggaatccccgacttcgccgggatcgagctgggcacgcccaccgcctccggcggcccc
gacgagtggcgtacggccctgaagaaggcgaccggcggcgacgacctcctctgggagacc
cccgagggcatcacggtcaagcctctctacaccgggcaggacgtcgagggcctggacttc
ctgggcacgtacccgggcatcgccccgtatctgcgcggcccgtacccgacgatgtacgtc
aaccagccctggaccatccgccagtacgcgggcttctccaccgccgaggagtccaacgcc
ttctaccggcgcaacctggcggccggccagaagggcctgtccgtcgccttcgacctgccc
acccaccgcggctacgacagcgaccacccccgcgtgaccggtgacgtcggcatggcgggc
gtggccatcgactcgatctacgacatgcggcagctcttcgacggcatcccgctcgacaag
atgaccgtgtcgatgacgatgaacggcgccgtgctgcccgtcctcgcgctctacatcgtg
gccgccgaggaacagggcgtgccgcccgagaaactggccgggaccatccagaacgacatc
ctcaaggagttcatggtccgcaacacctacatctatccgccgaagccgtcgatgcggatc
atctccgacatcttcgccttcacgtcgcagcggatgccgcggtacaactccatctccatc
tccgggtaccacatccaggaggcgggcgcgacggccgacctggagctcgcgtacacgctc
gccgacggcgtggagtacctgcgggccggccaggaggccggcctggacgtcgacgccttc
gcgccccggctctccttcttctgggcgatcggcatgaacttcttcatggagatcgccaag
atgcgggccgcgcgcctgctgtgggcgaagctggtcaagcagttcgacccgaagaacgcc
aagtccctctctctgcgcacccattcgcagacctccggctggtcgctgaccgcgcaggac
gtgttcaacaacgtgacgcgtacgtgtgtggaggcgatggcggccacccaaggccacacg
cagtccctgcacaccaacgcgctcgacgaggcgctcgcgctgcccaccgacttctcggcg
cgcatcgcccgcaacacgcagctgctgatccagcaggagtcgggcacgacccgggtgatc
gacccgtggggcggcagcgcgtacgtcgagaagctgacgtacgacctggcgcgccgggcc
tggcagcacatcgaggaggtcgaggcggcgggcggcatggcgcaggccatcgacgccggt
atcccgaagctccgggtggaggaggccgcggcccgcacccaggcgcggatcgactccggg
cgccagccggtcatcggcgtgaacaagtaccgcgtcgagaccgacgagaagatcgacgtc
ctcaaggtcgacaactcctccgtccgcgcccagcagatcgagaagctccggcggctgcgc
gcggagcgcgacgaacaggcctgccaggacgcgctgcacgccctgacccgcgccgccgag
ggcaccggcaacctgctggagctggccgtgaacgccgcccgcgcgaaggccaccgtcggg
gagatctccgacgccctggagaaggtgtacgggcggcacgcggggcagatccgtacgatc
tccggtgtgtaccgcaccgaagcaggcgagtctccgtccgtcgagcgcacccgtacgctc
gtgggctccttcgaggaggccgagggccgccgtccgcgcatcctggtcgccaagatgggc
caggacgggcacgaccgcggccagaaggtgatcgccaccgccttcgccgacctcggcttc
gacgtcgacgtcggcccgctcttccagacccccgccgaggtggcccgccaggccgtggag
gcggacgtgcacatcgtcggcgtctcctcgctggccgcggggcatctgaccctcgtaccg
gcgctgcgcgagcagctcgccgaagaggggcgcgaggacatcatgatcgtggtcggcggg
gtgatcccaccgcaggacgtgccgaccctgctggagatgggcgcggcagccgtcttcccg
cccggcacggtcatccccgacgcggcgtacgacctggtgacgcggctggccgccgatctc
ggacacgacctctga

KEGG   Streptomyces avermitilis: SAVERM_2832
Entry
SAVERM_2832       CDS       T00126                                 

Gene name
icmA
Definition
(GenBank) isobutyryl-CoA mutase, chain A
  KO
K01848  methylmalonyl-CoA mutase, N-terminal domain [EC:5.4.99.2]
Organism
sma  Streptomyces avermitilis
Pathway
sma00280  Valine, leucine and isoleucine degradation
sma00630  Glyoxylate and dicarboxylate metabolism
sma00640  Propanoate metabolism
sma01100  Metabolic pathways
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
Module
sma_M00741  Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SAVERM_2832 (icmA)
   00640 Propanoate metabolism
    SAVERM_2832 (icmA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAVERM_2832 (icmA)
Enzymes [BR:sma01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.2  methylmalonyl-CoA mutase
     SAVERM_2832 (icmA)
SSDB
Motif
Pfam: MM_CoA_mutase
Other DBs
NCBI-ProteinID: BAC70543
NITE: SAV2832
UniProt: Q82JC3
Position
complement(3477658..3479358)
AA seq 566 aa
MDADAIEEGRRRWQARYDASRKREADFTTLSGDPVEPAYGPRPGDAYEGFERIGWPGEYP
FTRGLYPTGYRGRTWTIRQFAGFGNAEQTNERYKKILANGGGGLSVAFDMPTLMGRDSDD
RRALGEVGHCGVAIDSAADMEVLFKDIPLGDVTTSMTISGPAVPVFCMYLVAAERQGVDP
SVLNGTLQTDIFKEYIAQKEWLFQPEPHLRLIGDLMEHCASKIPAYKPLSVSGYHIREAG
ATAAQELAYTLADGFGYVELGLSRGLDVDVFAPGLSFFFDAHVDFFEEIAKFRAARRIWA
RWLRDVYGAKSEKAQWLRFHTQTAGVSLTAQQPYNNVVRTAVEALAAVLGGTNSLHTNAL
DETLALPSEQAAEIALRTQQVLMEETGVANVADPLGGSWYVEQLTDRIEADAEKIFEQIR
ERGLRAHPDGRHPIGPITSGILRGIEDGWFTGEIAESAFQYQQALEKGDKRVVGVNVHHG
SVTGDLEILRVSHEVEREQVRVLGERKSGRDDTAVTAALDAMLAAARDGSNMIAPMLDAV
RAEATLGEICDVLREEWGVYTEPAGF
NT seq 1701 nt   +upstreamnt  +downstreamnt
atggacgctgacgccatcgaggaaggccgccgacgctggcaggcccgctacgacgcctca
cgcaagcgcgaggccgatttcaccacgctctccggcgatcccgtggagccggcgtacggg
ccccggcccggggacgcgtacgagggtttcgagcggatcggctggccgggtgagtacccc
ttcacgcgcggtctgtatccgaccggctaccggggccggacctggaccatccggcagttc
gccgggttcggcaacgccgagcagaccaacgagcgctacaagaagatcctcgccaacggc
ggcggtgggctgtccgtggccttcgacatgccgacgctcatggggcgcgactccgacgac
cgccgcgcgctcggcgaggtcgggcactgcggggtcgcgatcgactcggcggccgacatg
gaggtcctgttcaaggacatcccgctgggtgacgtgacgacgtcgatgacgatcagcggg
cccgccgtgcccgtcttctgcatgtacctggtcgcggccgagcggcagggcgtcgacccc
tccgtcctcaacggcaccctccagaccgacatcttcaaggagtacatcgcgcagaaggag
tggctcttccagcccgagccccatctgcggctcatcggcgacctgatggagcactgcgcc
tcgaagatccccgcgtacaagccgctgtccgtctccgggtaccacatccgggaggccggt
gccacggccgcccaggagctggcgtacaccctcgccgacggtttcggatacgtggagctg
gggctgagccgcggcctggacgtggacgtgttcgcgcccgggctctccttcttcttcgac
gcgcacgtcgacttcttcgaggagatcgccaagttccgtgcggcgcggcgcatctgggcg
cgctggctgcgggacgtgtacggggcgaagtcggagaaggcgcagtggctgcgcttccac
acccagaccgcgggcgtctcgctcaccgcgcagcagccgtacaacaacgtcgtacggacg
gccgtggaggccctcgccgcggtgctcggcgggacgaactcgctgcacaccaacgccctc
gacgagaccctcgccctgccgtccgagcaggcggccgagatcgccctgcgcacccagcag
gtgctgatggaggagacgggcgtcgccaacgtggccgatccgctgggcggttcctggtac
gtggagcagctgaccgaccggatcgaggccgacgccgagaagatcttcgaacagatcagg
gagcgcgggctgcgggcccacccggacgggcggcacccgatcgggcccatcacctccggc
atcctgcgcggcatcgaggacggctggttcaccggggagatcgccgagtcggccttccag
taccagcaggcgctggagaagggcgacaagcgggtcgtcggcgtcaacgtccaccacggg
tccgtgacgggcgacctggagatcctgcgcgtcagccacgaggtggagcgcgagcaggtg
cgggtgctgggcgagcggaagtcggggcgcgacgacacggccgtaaccgcggccctggac
gcgatgctcgccgccgcgcgcgacgggtcgaacatgatcgccccgatgctggacgcggtc
cgcgcggaggccacgctgggcgagatctgcgatgtcctccgggaggagtggggggtctac
acggagcccgccggtttctga

KEGG   Streptomyces avermitilis: SAVERM_3382
Entry
SAVERM_3382       CDS       T00126                                 

Gene name
mcmA2
Definition
(GenBank) putative methylmalonyl-CoA mutase, alpha subunit
  KO
K01848  methylmalonyl-CoA mutase, N-terminal domain [EC:5.4.99.2]
Organism
sma  Streptomyces avermitilis
Pathway
sma00280  Valine, leucine and isoleucine degradation
sma00630  Glyoxylate and dicarboxylate metabolism
sma00640  Propanoate metabolism
sma01100  Metabolic pathways
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
Module
sma_M00741  Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SAVERM_3382 (mcmA2)
   00640 Propanoate metabolism
    SAVERM_3382 (mcmA2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAVERM_3382 (mcmA2)
Enzymes [BR:sma01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.2  methylmalonyl-CoA mutase
     SAVERM_3382 (mcmA2)
SSDB
Motif
Pfam: MM_CoA_mutase
Other DBs
NCBI-ProteinID: BAC71094
NITE: SAV3382
UniProt: Q82HX5
Position
complement(4202111..4203691)
AA seq 526 aa
MARESESGLPIEPVYGPEALEGWDPAQKLGTPGAYPFTRGVYPSMYTGRPWTMRQYAGFG
TAVESNARYKQLIANGTMGLSVAFDLPTQMGHDSDAPIAHGEVGKVGVAIDSVEDMRVLL
GGIPLDKVSTSMTINAPAALLLLMYQLVGEEQGVPADRLTGTIQNDVLKEYIARGTYIFP
PKPSLRLIADIFKYCKTEIPKWNTISISGYHMAEAGASPAQEIAFTLADGIEYVRTAVAA
GMDVDDFAPRLSFFFVSRTTILEEVAKFRAARRIWARVMRDEFGAKNPKSLMLRFHTQTA
GVQLTAQQPEVNLVRVAVQGLAAVLGGTQSLHTNSFDEAIALPTDKSARLALRTQQVLAY
ETDVTATVDPFAGSYVVEKMTDEVEAATVELMAKVEELGGAVNAIERGFQKGEIERSAYR
IAQETDSGERVVVGVNRFQLEAEEPYEPLRVDPAIEAQQAERLAKLRAERDRSAVDAALA
DLKKAAEGTDNVLYPMKDALRARATVGEVCNALREVWGTYVPSDAF
NT seq 1581 nt   +upstreamnt  +downstreamnt
atggcgcgcgagtcggagtccggactgcccatcgagccggtctacgggcctgaggcgctg
gagggctgggatccggcccagaagctggggacgcccggcgcgtaccccttcacacgtggt
gtgtacccgtccatgtacacgggtcggccctggacgatgcggcagtacgccggcttcggc
acggcggtggagtccaacgcgcgctacaagcagctgatcgcgaacggcacgatgggtctg
tcggtcgcgttcgacctccccacccagatgggccacgactccgatgccccgatcgcgcac
ggcgaggtcggcaaggtgggcgtcgcgatcgactcggtcgaggacatgcgggtgctcctc
ggcgggatcccgctggacaaggtgtcgacgtcgatgacgatcaacgctccggccgcgctg
ctcctgctcatgtaccagctggtcggcgaggaacagggcgttccggcggaccggctgacg
ggcacgatccagaacgacgtcctcaaggagtacatcgcgcggggcacgtacatcttcccg
cccaagccctccctgcggctgatcgccgacatcttcaagtactgcaagaccgagatcccg
aagtggaacacgatctcgatctccggctaccacatggcggaggcgggcgcgtccccggcg
caggagatcgcgttcacgctggcggacggcatcgagtacgtccgtacggccgtggccgcg
ggcatggacgtggacgacttcgccccgcgcctgtccttcttcttcgtctcccgtacgacg
atcctcgaagaggtcgccaagttccgtgcggccaggcggatctgggcccgcgtgatgcgc
gacgagttcggcgccaagaaccccaagtcgctgatgctgcgcttccacacgcagacggcc
ggcgtgcagctgacggcccagcagccggaggtgaacctggtccgggtggcggtccagggc
ctggccgcggtgctcggcggtacgcagtcgctgcacacgaactcgttcgacgaggcgatc
gcgctgcccacggacaagtccgcgcgcctcgccctgcgcacccagcaggtgctggcgtac
gagacggacgtcacggcgacggtcgaccccttcgcgggcagctacgtcgtcgagaagatg
acggacgaggtggaggccgcgacggtcgagctgatggcgaaggtggaggagctgggcggc
gcggtcaacgcgatcgagcgcggcttccagaagggcgagatcgagcgctccgcgtaccgc
atcgcccaggagacggactcgggcgagcgggtggtggtcggcgtcaaccgcttccagctc
gaggcggaagagccctacgagcccctccgtgtcgacccggccatcgaggcccagcaggcg
gaacgcctcgccaaactccgcgccgagcgcgaccggtcggccgtcgacgccgccctcgcc
gacctgaagaaggcggccgagggcacggacaacgtcctctacccgatgaaggacgccctg
cgcgcccgcgccacggtgggcgaggtgtgcaacgcgctgcgggaggtctgggggacctac
gtgccgtcggacgcgttctga

KEGG   Streptomyces avermitilis: SAVERM_3460
Entry
SAVERM_3460       CDS       T00126                                 

Gene name
icmB
Definition
(GenBank) isobutyryl-CoA mutase, chain B
  KO
K01849  methylmalonyl-CoA mutase, C-terminal domain [EC:5.4.99.2]
Organism
sma  Streptomyces avermitilis
Pathway
sma00280  Valine, leucine and isoleucine degradation
sma00630  Glyoxylate and dicarboxylate metabolism
sma00640  Propanoate metabolism
sma01100  Metabolic pathways
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
Module
sma_M00741  Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SAVERM_3460 (icmB)
   00640 Propanoate metabolism
    SAVERM_3460 (icmB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAVERM_3460 (icmB)
Enzymes [BR:sma01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.2  methylmalonyl-CoA mutase
     SAVERM_3460 (icmB)
SSDB
Motif
Pfam: B12-binding
Other DBs
NCBI-ProteinID: BAC71172
NITE: SAV3460
UniProt: Q82HP8
Position
complement(4289212..4289628)
AA seq 138 aa
MGVAAGPIRVVVAKPGLDGHDRGAKVIARALRDAGMEVIYTGLHQTPEQIVGTAIQEDAD
AIGLSILSGAHNTLFAAVIDLLKERDAEDIKVFGGGIIPEADIAPLKEKGVAEIFTPGAT
TASIVEWVRANVRQPAGA
NT seq 417 nt   +upstreamnt  +downstreamnt
atgggtgtggcagccggtccgatccgcgtggtggtggccaagccggggctcgatggccac
gatcgcggggccaaggtgatcgcgcgggcgctgcgcgatgccggtatggaggtcatttac
acggggctgcaccagacgccggagcagatcgtgggcacggccatccaggaggacgccgac
gcgatcgggctgtcgatcctgtccggggcgcacaacacgttgttcgcggcggtcatcgat
ctgctcaaggagcgcgatgccgaggacatcaaggtgttcggtggcggcatcatccccgag
gcggacatcgcgccgctgaaggagaagggtgtcgcggagatcttcactccgggggcgacc
acggcgtcgatcgtggagtgggtgcgggcgaacgtgcggcagcctgccggggcgtag

DBGET integrated database retrieval system