KEGG   Streptomyces avermitilis: SAVERM_2147Help
Entry
SAVERM_2147       CDS       T00126                                 

Gene name
dnaQ3
Definition
(GenBank) putative DNA polymerase III epsilon subunit
  KO
K02342  DNA polymerase III subunit epsilon [EC:2.7.7.7]
Organism
sma  Streptomyces avermitilis
Pathway
sma03030  DNA replication
sma03430  Mismatch repair
sma03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SAVERM_2147 (dnaQ3)
   03430 Mismatch repair
    SAVERM_2147 (dnaQ3)
   03440 Homologous recombination
    SAVERM_2147 (dnaQ3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sma03032]
    SAVERM_2147 (dnaQ3)
   03400 DNA repair and recombination proteins [BR:sma03400]
    SAVERM_2147 (dnaQ3)
Enzymes [BR:sma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     SAVERM_2147 (dnaQ3)
DNA replication proteins [BR:sma03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     SAVERM_2147 (dnaQ3)
DNA repair and recombination proteins [BR:sma03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     SAVERM_2147 (dnaQ3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNase_T DUF5051 RNase_H_2
Motif
Other DBs
NCBI-ProteinID: BAC69858
NITE: SAV2147
UniProt: Q82L65
Position
complement(2613862..2614584)
Genome map
AA seq 240 aa AA seqDB search
MAWHEQLLIGFDLETTGTDPREARIVTGAVIEVKGQEPVGRREWLADPGVEIPADAVAVH
GITNERAAAEGGPPDRVAESLAQTLVGYWRTGVPVVAYNATFDLTLLSAELRRYGLPSLR
ERLDGRDPAPVIDPYTIDRWVDRYRRGKRNLEAVCTEYGVPLDAAHDATADALAAARLAA
AIAHRHPKIAALGPAELHRRQIEWYAAWAADFQSFLRRKGDTAAVVDGTWPLREPADETV
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggcctggcacgagcagctgctgatcggcttcgacctggagacgaccggaacggatccg
cgcgaggcgcgcatcgtcaccggcgcggtcatagaggtcaagggtcaagagccggtcgga
cgccgcgagtggctggccgacccgggcgtggagatcccggcggacgcggtggccgtgcac
gggatcaccaatgagcgggccgcggccgagggcggtccccccgaccgggtcgccgagtcc
ctggcgcagaccctcgtggggtactggcgaaccggagtgccggtcgtggcgtacaacgcg
accttcgacctcaccctcctgtccgccgaactgcgccggtacggactgccgtcgctgcgc
gagcggctcgacggccgcgacccggcaccggtgatcgacccgtacacgatcgaccgctgg
gtggaccgctaccgccgcggcaagcggaacctcgaggcggtctgcacggagtacggcgtc
cccctggacgccgcgcacgacgcgaccgcggacgccctggccgcggcccggctcgccgcc
gcgatagcccaccgccacccgaagatcgccgcgctcggcccggcggagctgcaccgccgc
cagatcgagtggtacgcggcctgggcggcggacttccagagcttcctgcgccgcaagggc
gacacggcggcggtcgtggacggcacatggccgctgcgggagccggcggacgaaacggtc
tga

KEGG   Streptomyces avermitilis: SAVERM_6439Help
Entry
SAVERM_6439       CDS       T00126                                 

Gene name
dnaQ1
Definition
(GenBank) putative DNA polymerase III epsilon subunit
  KO
K02342  DNA polymerase III subunit epsilon [EC:2.7.7.7]
Organism
sma  Streptomyces avermitilis
Pathway
sma03030  DNA replication
sma03430  Mismatch repair
sma03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SAVERM_6439 (dnaQ1)
   03430 Mismatch repair
    SAVERM_6439 (dnaQ1)
   03440 Homologous recombination
    SAVERM_6439 (dnaQ1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sma03032]
    SAVERM_6439 (dnaQ1)
   03400 DNA repair and recombination proteins [BR:sma03400]
    SAVERM_6439 (dnaQ1)
Enzymes [BR:sma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     SAVERM_6439 (dnaQ1)
DNA replication proteins [BR:sma03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     SAVERM_6439 (dnaQ1)
DNA repair and recombination proteins [BR:sma03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     SAVERM_6439 (dnaQ1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNase_T DUF5051 BRCT HisKA_3 PTCB-BRCT RNase_H_2 DNA_pol_A_exo1
Motif
Other DBs
NCBI-ProteinID: BAC74150
NITE: SAV6439
UniProt: Q829H2
Position
complement(7715780..7716757)
Genome map
AA seq 325 aa AA seqDB search
MLEDRTTAATPAPWPAAYPQGYAVVDVETTGLARDDRIISAAVYRLDARGEVEDHWYTMV
NPERDPGPVWIHGLTSDVLEGAPLFEDIAAEFASRLADRVLVAHNAVFDWSMIAREYARA
KSQAPVRQRLCTIALSKELGLPLPNHKLESLAAHFGVVQQRAHHALDDARVLAEAFRPSL
HAAARDGVRLPLLECLPLTEWNATPRIGRQPSGGYPSGSWRPSRKRPVCPYPNPGRYEEG
KPLKQGMRVAFSGDTSVDRELLEDRAVEAGLHVATSLSRLTSLLVTNDPGSGTSKTAKAR
QYGTPVIDEAAFGQLLRDVEPASQG
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgctcgaagaccgtacgaccgcagcgaccccagccccctggccggccgcgtatccacag
gggtacgcggtcgtcgacgtggagaccaccggcctggcccgggacgaccggatcatctcg
gccgccgtctaccggctggacgcgcgcggcgaggtcgaggaccactggtacacgatggtc
aacccggagcgggacccgggcccggtgtggatccacgggctgacgagcgatgtcctcgaa
ggggcaccgctcttcgaggacatcgcggcggagttcgcgtcccggctcgccgaccgcgtg
ctcgtcgcgcacaacgcggtcttcgactggtcgatgatcgcccgggagtacgcgcgcgcg
aagagccaggcgccggtgcggcagcggctgtgcaccatcgcgctctccaaggagctgggc
ctgccgctgcccaaccacaagctggagtcgctggccgcgcacttcggcgtcgtacagcag
cgggcccaccacgccctggacgacgcgcgcgtgctggccgaggcgttccggccgagtctg
cacgcggcggcgcgggacggcgtccggctgccgctgctggagtgcctgccgctcaccgag
tggaacgccaccccgcggatcggccggcagccctccggcggctatccgtccggcagttgg
cgcccctcccgcaaacgccccgtatgcccctatcccaacccgggtcgctacgaagagggc
aaaccgctcaagcaaggcatgcgggtggcgttctccggggacacctcggtcgaccgcgag
ctcctcgaggaccgcgccgtcgaggcgggcctgcatgtggcgacgagcctgtcccggctc
accagcctgctcgtcaccaacgaccccggctcgggtacgtccaagacggccaaggcgcgg
cagtacgggacaccggtgatcgacgaggcggcgttcggccagctgctgcgggacgtggag
ccggcctcgcaggggtga

DBGET integrated database retrieval system