KEGG   Streptomyces avermitilis: SAVERM_2154
Entry
SAVERM_2154       CDS       T00126                                 

Gene name
lpdA2
Definition
(GenBank) putative dihydrolipoamide dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
sma  Streptomyces avermitilis
Pathway
sma00010  Glycolysis / Gluconeogenesis
sma00020  Citrate cycle (TCA cycle)
sma00260  Glycine, serine and threonine metabolism
sma00280  Valine, leucine and isoleucine degradation
sma00310  Lysine degradation
sma00380  Tryptophan metabolism
sma00620  Pyruvate metabolism
sma00630  Glyoxylate and dicarboxylate metabolism
sma00640  Propanoate metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
Module
sma_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sma_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sma_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAVERM_2154 (lpdA2)
   00020 Citrate cycle (TCA cycle)
    SAVERM_2154 (lpdA2)
   00620 Pyruvate metabolism
    SAVERM_2154 (lpdA2)
   00630 Glyoxylate and dicarboxylate metabolism
    SAVERM_2154 (lpdA2)
   00640 Propanoate metabolism
    SAVERM_2154 (lpdA2)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAVERM_2154 (lpdA2)
   00280 Valine, leucine and isoleucine degradation
    SAVERM_2154 (lpdA2)
   00310 Lysine degradation
    SAVERM_2154 (lpdA2)
   00380 Tryptophan metabolism
    SAVERM_2154 (lpdA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sma04147]
    SAVERM_2154 (lpdA2)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     SAVERM_2154 (lpdA2)
Exosome [BR:sma04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   SAVERM_2154 (lpdA2)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox GIDA FAD_oxidored Pyr_redox_3 AlaDh_PNT_C FAD_binding_2 HI0933_like NAD_binding_8 DAO 3HCDH_N Thi4 Trp_halogenase Lycopene_cycl
Other DBs
NCBI-ProteinID: BAC69865
NITE: SAV2154
UniProt: Q82L58
Position
2624596..2626032
AA seq 478 aa
MENMNTPDVIVIGGGTGGYSAALRAAALGLTVVLAERDKVGGTCLHRGCIPSKAMLHAAE
LVDGIAEARERWGVKATLDDIDWPALVATRDDIVTRNHRGVEAHLAHARVRVVRGSARLT
GPRSVRVEGAPDDLPGGAGDFTARRGIVLATGSRPRTLPGLVPDGRRVVTSDDALFAPGL
PRSVLVLGGGAIGVEYASFHRSMGAEVTLVEAADRIVPLEDVDVSRHLTRGLKKRGIDVR
AGARLLDAELLEAGVRARVRTVRGEIRTLEAERLLVAVGRAPVTDGLDLAAAGLATDERG
FVTPSDWDRLETAVPGIHVVGDLLPPPSLGLAHASFAEGLSVAETLAGLPSAPVDYAAVP
RVTYSSPQTASVGLGEAEARARGHEVDVNTMPLTAVAKGMVHGRGGMVKVVAEEGGGQVL
GVHLVGPHVSEMIAESQLIVGWDAQPSDVARHIHAHPTLSEAVGETFLTLAGRGLHQQ
NT seq 1437 nt   +upstreamnt  +downstreamnt
gtggagaacatgaacacaccggacgtcatcgtcatcggaggcggcaccggcggctacagc
gccgccctgcgcgccgccgccctcggtctgaccgtggtgctcgccgagcgggacaaggtc
ggcggaacctgtctgcaccgtggctgcattccgagcaaggcgatgctgcacgccgcagaa
ctggtcgacggcatcgccgaggcgcgcgagcgctggggggtgaaggccacgctggacgac
atcgactggcctgcgctcgtcgccacgcgcgacgacatagtgacgcgcaaccaccgcggc
gtggaggcgcacctcgcccacgcgcgcgtgcgcgtcgtccggggcagtgcccggctgacc
ggtccgcgcagcgtccgcgtcgagggtgctccggacgacctgccgggcggcgcgggcgac
ttcaccgcgcgccggggcatcgtcctggcgaccggctcacggccgcgtacgctcccgggg
ctcgtgccggacgggcggcgcgtggtgacgagcgacgacgcgctgttcgcgcccggcctc
ccccgctccgtgctggtcctgggcggcggtgcgatcggggtcgagtacgcctcgttccac
cgctccatgggtgcggaggtcactctcgtcgaggccgccgaccggatcgtgccgctcgaa
gacgtcgacgtcagccgtcatctgacgcgcggtctgaagaagcgcggcatcgatgtgcgg
gcgggggcgcggctgctcgacgccgaactcctggaggcgggggtacgcgcgcgcgtacgc
accgtgcggggcgagatccgcacactggaggccgagcggctcctggtggcggtcgggcgg
gcgccggtcaccgacgggctggacctggccgccgcgggcctggcgacggacgagcggggt
tttgtgacgccgtccgactgggaccgtctggagaccgcggtgcccggcatccacgtggtg
ggcgacctgctgccaccgccgtccctgggactggcccacgcgtcgttcgccgagggcctg
tcggtggccgagacgctggccgggctgccgtccgcgcccgtggactacgcggccgtgccc
cgggtcacgtactcgtcgccgcagaccgcctccgtggggctgggcgaggcggaggcacgc
gcgcgtggacacgaggtggacgtcaacacgatgccgctgaccgccgtcgccaagggcatg
gtccacggccggggcgggatggtgaaggtcgtcgccgaggagggcggcgggcaggtgctc
ggcgtgcatctggtgggcccccacgtgtccgagatgatcgccgagagccagctgatcgtc
ggctgggacgcacagccctccgacgtggcccggcacatccacgcgcaccccacgctgtcc
gaggcggtcggcgaaacgtttctcacgctcgcgggacgggggctgcatcagcagtga

KEGG   Streptomyces avermitilis: SAVERM_6024
Entry
SAVERM_6024       CDS       T00126                                 

Gene name
lpdA1
Definition
(GenBank) putative dihydrolipoamide dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
sma  Streptomyces avermitilis
Pathway
sma00010  Glycolysis / Gluconeogenesis
sma00020  Citrate cycle (TCA cycle)
sma00260  Glycine, serine and threonine metabolism
sma00280  Valine, leucine and isoleucine degradation
sma00310  Lysine degradation
sma00380  Tryptophan metabolism
sma00620  Pyruvate metabolism
sma00630  Glyoxylate and dicarboxylate metabolism
sma00640  Propanoate metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
Module
sma_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sma_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sma_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAVERM_6024 (lpdA1)
   00020 Citrate cycle (TCA cycle)
    SAVERM_6024 (lpdA1)
   00620 Pyruvate metabolism
    SAVERM_6024 (lpdA1)
   00630 Glyoxylate and dicarboxylate metabolism
    SAVERM_6024 (lpdA1)
   00640 Propanoate metabolism
    SAVERM_6024 (lpdA1)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAVERM_6024 (lpdA1)
   00280 Valine, leucine and isoleucine degradation
    SAVERM_6024 (lpdA1)
   00310 Lysine degradation
    SAVERM_6024 (lpdA1)
   00380 Tryptophan metabolism
    SAVERM_6024 (lpdA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sma04147]
    SAVERM_6024 (lpdA1)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     SAVERM_6024 (lpdA1)
Exosome [BR:sma04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   SAVERM_6024 (lpdA1)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox GIDA Pyr_redox_3 FAD_oxidored HI0933_like FAD_binding_2 AlaDh_PNT_C NAD_binding_8 T2SS-T3SS_pil_N DAO Trp_halogenase Amino_oxidase 3HCDH_N
Other DBs
NCBI-ProteinID: BAC73735
NITE: SAV6024
UniProt: Q82AN3
Position
complement(7252581..7253969)
AA seq 462 aa
MANDASTVFDLVILGGGSGGYAAALRGAQLGLDVALIEKDKVGGTCLHRGCIPTKALLHA
GEIADQARESEQFGVKATFEGIDVPAVHKYKDGVISGLYKGLQGLIASRKVTYIEGEGRL
SSPTSVDVNGQRVQGRHVLLATGSVPKSLPGLAIDGNRIISSDHALVLDRVPESAIVLGG
GVIGVEFASAWKSFGADVTVIEGLKHLVPVEDENSSKLLERAFRKRGIKFNLGTFFSKAE
YTQNGVKVTLADGKEFEAEVLLVAVGRGPVSQGLGYEEQGVAMDRGYVLVDEYMRTNVPT
ISAVGDLVPTLQLAHVGFAEGILVAERLAGLKTVPIDYDGVPRVTYCHPEVASVGITEAK
AKEIYGADKVVALKYNLAGNGKSKILNTAGEIKLVQVKDGAVVGVHMVGDRMGEQVGEAQ
LIYNWEALPAEVAQLIHAHPTQNEAMGEAHLALAGKPLHSHD
NT seq 1389 nt   +upstreamnt  +downstreamnt
gtggcgaacgacgccagcaccgttttcgacctagtgatcctcggcggtggtagcggtggt
tacgccgcggccctgcgcggagcgcagctgggcctggacgtcgccctgatcgagaaggac
aaggtcggcggtacctgcctgcaccgtgggtgcatccccaccaaggcgctgctgcacgcg
ggcgagatcgccgaccaggcccgcgagagcgagcagttcggcgtcaaggccaccttcgag
ggcatcgacgtaccggccgtccacaagtacaaggacggggtcatctcgggcctgtacaag
ggtctgcaggggctgatcgcctcccgcaaggtgacgtacatcgagggtgagggccgtctg
tcctccccgacctccgtcgacgtgaacggccagcgcgtccagggccgccacgtgctcctg
gcgaccggctccgtgccgaagtcgctgccgggcctggcgatcgacggcaaccgcatcatc
tcctccgaccacgcgctggtcctggaccgcgtcccggagtccgcgatcgtgctcggcggc
ggcgtcatcggcgtcgagttcgcctccgcgtggaagtccttcggagccgacgtgacggtg
atcgagggcctcaagcacctcgtcccggtcgaggacgagaactcctccaagcttcttgag
cgcgcgttccgcaagcgcggcatcaagttcaacctgggcaccttcttctcgaaggccgag
tacacccagaacggtgtcaaggtcaccctcgccgacggcaaggagttcgaggccgaggtc
ctgctcgtcgccgtcggccgcggcccggtctcgcagggcctcggctacgaggagcagggc
gtcgccatggaccgcggctacgtcctggtcgacgagtacatgcggacgaacgtcccgacc
atctccgccgtcggtgacctggtcccgacgctccagctcgcgcacgtcggcttcgccgag
ggcatcctggtggcggagcgtctggccggtctgaagaccgtcccgatcgactacgacggc
gtgccgcgggtgacgtactgccaccccgaggtcgcctccgtgggcatcaccgaggccaag
gccaaggagatctacggcgcggacaaggtcgtcgctctgaagtacaacctggcgggcaac
ggcaagagcaagatcctcaacaccgcgggcgagatcaagctcgtccaggtgaaggacggt
gccgtggtcggcgtccacatggtcggtgaccgtatgggcgagcaggtcggcgaagcccag
ctgatctacaactgggaggcgctgccggccgaggtcgcccagctcatccacgcccacccg
acgcagaacgaagcgatgggcgaggcccacctggccctcgcgggcaagccgctgcactcg
cacgactga

DBGET integrated database retrieval system