KEGG   Streptomyces avermitilis: SAVERM_2205Help
Entry
SAVERM_2205       CDS       T00126                                 

Gene name
murC
Definition
(GenBank) putative UDP-N-acetylmuramoyl-L-alanine ligase
  KO
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
sma  Streptomyces avermitilis
Pathway
sma00471  D-Glutamine and D-glutamate metabolism
sma00550  Peptidoglycan biosynthesis
sma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    SAVERM_2205 (murC)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SAVERM_2205 (murC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sma01011]
    SAVERM_2205 (murC)
Enzymes [BR:sma01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     SAVERM_2205 (murC)
Peptidoglycan biosynthesis and degradation proteins [BR:sma01011]
 Precursor biosynthesis
  Amino acid ligase
   SAVERM_2205 (murC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase Mur_ligase_M Mur_ligase_C LUD_dom CbiA EBV-NA1
Motif
Other DBs
NCBI-ProteinID: BAC69916
NITE: SAV2205
UniProt: Q82L07
Position
complement(2684471..2685865)
Genome map
AA seq 464 aa AA seqDB search
MAPGLPTAMDRPHFIGIGGAGMSGIAKILAQRGAKVAGSDAKESETAEALRALGATVHIG
HAAEHLADDATCVVVSSAIRADNPELARAAELGIPVVHRSDALARLMDGLRPIAVAGTHG
KTTTTSMLAVSLSTLGLAPSYAIGGDLDAPGSNALHGEGDIFVAEADESDRSFHKYAPDV
AIVLNVELDHHANYASMDEIYASFETFVDRITEGGTLVIAADHEGARELTRRVTASGVRV
VTYGESADADVCVLSVTAQGLKSEVEVLLDGTELTFTVSVPGRHYAHNAVAALAAGVALG
IPAADLASALAAYTGVKRRLQLKGEEAGVQVIDSYAHHPTEMTADLEAMRAAAGDARILV
VFQPHLFSRTQELGKEMGQALALADASVVLDIYPAREDPIPGITSELIIEAARAAGADVT
PVHDKAEVPSVIAGMARPGDLVLTMGAGDVTELGPRILDRLSKQ
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggcacccggtcttcctaccgccatggaccgaccgcacttcatcgggatcggcggcgcc
gggatgtcgggcatcgcgaagatcctcgcgcagcgcggggccaaggtggccggcagcgac
gcgaaggagtccgagaccgccgaggccctgcgggcactgggcgcgacggtgcacatcggg
cacgcggccgagcacctcgccgacgacgccacgtgcgtcgtcgtctcctccgcgatccgc
gcggacaacccggagctggcccgcgcggcggagctgggcatcccggtcgtccaccgttcg
gacgccctggcccggctgatggacggcctgcgcccgatcgcggtggcgggcacgcacggc
aagacgaccacgacgtcgatgctggcggtgtcgctgtccacgctgggcctcgccccgtcg
tacgcgatcggcggcgacctggacgcccccggctcgaacgcgctgcacggcgagggcgac
atcttcgtcgccgaggcggacgaatcggaccgcagcttccacaagtacgcgcccgacgtg
gcgatcgtgctgaacgtggagctggaccaccacgccaactacgcgtccatggacgagatc
tacgcgtccttcgagaccttcgtggaccgcatcaccgagggcggcacgctggtgatcgcg
gcggaccacgagggcgcgcgggagctgacgcggcgcgtcacggcgagcggcgtacgggtg
gtgacgtacggcgagtcggcggacgccgacgtgtgcgtcctgtccgtgaccgcgcagggc
ctgaagagcgaggtggaggtcctgctcgacggcacggagctgaccttcacggtgtcggtc
cccggccggcactacgcgcacaacgcggtggcggcgctcgcggcgggggtggcgctgggc
atcccggccgcggacctcgcttcggccctggccgcctacacgggggtgaagcggcgcctc
cagctcaagggtgaggaggcgggcgtccaggtcatcgactcgtacgcgcaccacccgacg
gagatgaccgcggacctggaggcgatgcgggcggcggcgggtgacgcacggatcctggtc
gtcttccagccgcacctgttctcgcgcacgcaggagctgggcaaggagatggggcaggcc
ctggcgctcgcggacgcgtccgtggtcctggacatctacccggcccgcgaggacccgatc
ccgggcatcacgagcgagctgatcatcgaggcggcgcgggcggcgggcgcggacgtgacg
ccggtgcacgacaaggcggaggtcccgtcggtgatcgcgggaatggcgaggccgggcgat
ctggttctcaccatgggcgcgggcgacgtgacggagctcggcccgcggatcctggaccgt
ctgtcgaagcagtga

DBGET integrated database retrieval system