KEGG   Streptomyces avermitilis: SAVERM_2285
Entry
SAVERM_2285       CDS       T00126                                 

Gene name
rocD3
Definition
(GenBank) putative ornithine aminotransferase
  KO
K09251  putrescine aminotransferase [EC:2.6.1.82]
Organism
sma  Streptomyces avermitilis
Pathway
sma00310  Lysine degradation
sma00330  Arginine and proline metabolism
sma01100  Metabolic pathways
sma01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    SAVERM_2285 (rocD3)
   00330 Arginine and proline metabolism
    SAVERM_2285 (rocD3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sma01007]
    SAVERM_2285 (rocD3)
Enzymes [BR:sma01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.82  putrescine---2-oxoglutarate transaminase
     SAVERM_2285 (rocD3)
Amino acid related enzymes [BR:sma01007]
 Aminotransferase (transaminase)
  Class III
   SAVERM_2285 (rocD3)
SSDB
Motif
Pfam: Aminotran_3
Other DBs
NCBI-ProteinID: BAC69996
NITE: SAV2285
UniProt: Q79ZH2
Position
2787876..2789159
AA seq 427 aa
MTVIQESPVDTEAEILGLYRAHLSKGRATLAELFGSHMETASEGAWLTTSDGERFLNAGG
YGVFIMGARHPIVMEEVERQLRTHPTATRILLEPTVARAAEALVSVLPDGLDRVHFALSG
AEAVETGLKLARAGGRKRTISMRGGYHGKTLGALSATAKDVYQAPFRPLVPDFQHLPFGE
TDALEAELAAHPGEVCVILEPVQGEGGVIIPPAGYLKRVEELVRAHDGFLILDEVQSGFG
RLGEWWGADTEGVVPDVLLTGKALGGGVMPVSAAVATRKAFRPFDKDPYVHTATFSGQPV
LMAAVQGAIRAMKEERLVTRAMDLGAQLLPRIAEIAYRNIPELVVDVRGQGLLIGVELVE
AGLAGELLIELFNHGVVANHSMNGSSVVRFTPPAVLSDTDVEFLLNSFDLATRDLVRGAA
KMPEGGN
NT seq 1284 nt   +upstreamnt  +downstreamnt
gtgaccgtcatccaggaatcacccgtcgacaccgaggcggagatcctcggcctgtaccgg
gcccatctcagcaagggccgggccaccctcgccgagctcttcggcagccacatggagacg
gcgtccgagggcgcctggctcaccaccagcgacggtgagcgcttcctcaacgcgggcggc
tacggcgtgttcatcatgggcgcccgccacccgatcgtgatggaggaggtggagcgccag
ctgcggacgcatcccaccgcgacgcgcatcctgctggagcccaccgtggcccgcgccgcc
gaggcgctcgtctccgtgctgcccgacggcctggaccgggtgcacttcgcgctgtcgggc
gccgaggcggtggagaccggcctcaagctggcacgggccggcggccgcaagcggaccatc
tcgatgcgcggcggctaccacggcaagacgctcggcgcgctgtccgccaccgccaaggac
gtctaccaggcgccgttccggcccctggtgccggacttccagcacctgccgttcggcgaa
acggacgcgctggaggcggaactcgcggcccaccccggcgaggtctgcgtcatcctcgaa
cccgtacagggcgagggcggcgtgatcattccgcccgcgggctacctcaagcgcgtcgag
gaactggtccgcgcccacgacggattcctgatcctcgacgaggtgcagtccggtttcggc
cggctcggcgagtggtggggcgcggacaccgagggcgtggtgcccgacgtgctcctcacc
ggcaaggccctcggcggtggcgtcatgccggtctccgcggccgtggcgacccgcaaggcc
ttccgccccttcgacaaggacccgtacgtccacaccgccaccttctccgggcagccggtg
ctgatggccgcggtgcagggcgcgatccgggccatgaaggaggagcgcctggtcacccgg
gccatggacctcggcgcgcagctgctgccgaggatcgcggagatcgcgtaccgcaacatc
cccgaactcgtcgtggacgtgcgcggccaggggctgctcatcggcgtggagctcgtcgag
gccggactggccggcgagctgctgatcgagctgttcaaccacggtgtggtcgccaaccac
tcgatgaacggcagctcggtggtgcggttcaccccgcccgccgtgctgagcgacaccgat
gtggagttcctcctgaactccttcgacctggccacacgcgacctcgtccggggcgcggcc
aagatgccggaaggcggtaactga

DBGET integrated database retrieval system