KEGG   Streptomyces avermitilis: SAVERM_2319
Entry
SAVERM_2319       CDS       T00126                                 

Gene name
argF
Definition
(GenBank) putative ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
sma  Streptomyces avermitilis
Pathway
sma00220  Arginine biosynthesis
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01230  Biosynthesis of amino acids
Module
sma_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    SAVERM_2319 (argF)
Enzymes [BR:sma01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     SAVERM_2319 (argF)
SSDB
Motif
Pfam: OTCace OTCace_N DUF2407_C
Other DBs
NCBI-ProteinID: BAC70030
NITE: SAV2319
UniProt: Q82KQ4
Position
complement(2822927..2823934)
AA seq 335 aa
MATVPTALAGRHFLKELDFTAEEFRGLLELAAELKAAKKARTETLYLRGRNIALVFEKTS
TRTRCAFEVAAADQGASTTYLDPAGSQIGHKESVKDTARVLGRMFDGIEYRGHGQGVVEE
LAAHAGVPVYNGLTDEWHPTQMLADALTMTEHSDKPLTEIAYAYLGDARYNMGNSYLVTG
ALLGMDVRIVAPRLLWPDETIVEVAQQLAVASGARITLTEDVKEGVRGADFVATDVWVSM
GEPKEVWDERIGLLGPYAVTMDVLRATGNDDVKFLHCLPAFHDLGTDIGREIHARHGLTS
LEVTDEVFESAHSVVFDEAENRMHTIKAVLVATLA
NT seq 1008 nt   +upstreamnt  +downstreamnt
atggcgacagtcccgaccgccctcgccggccgccatttcctcaaggagctggatttcacc
gcggaggagttccgcgggctgctcgagctggccgccgagctgaaggccgccaagaaggcc
cggacggagacgctgtatctgcggggccgcaacatcgcgctcgtgttcgagaagacgtcg
acgcgtacgcgctgcgcgttcgaggtggccgcggccgaccagggtgcctccacgacgtac
ctcgacccggcgggctcgcagatcgggcacaaggagtcggtcaaggacacggcacgcgta
ctcggtcgcatgttcgacggcatcgagtatcgcggccacggccagggcgtcgtcgaggag
ctcgccgcgcacgccggagtccctgtctacaacggcctcaccgacgagtggcaccccacc
cagatgctcgccgacgcgctcaccatgaccgagcacagcgacaagccgctgaccgagatc
gcctacgcctacctcggcgacgcccgctacaacatgggcaactcctacctcgtcacgggc
gccctgctcggcatggacgtccggatcgtcgcgccccggctgctgtggcccgacgagacg
atcgtcgaggtggctcagcagctcgccgtcgcgtccggcgcccgcatcacgctcaccgag
gacgtgaaggagggcgtgcgcggcgcggacttcgtcgccaccgacgtctgggtgtcgatg
ggggagcccaaggaggtctgggacgagcgcatagggctgctcggcccctacgccgtgacg
atggacgtgctgcgcgccaccggcaacgacgacgtgaagttcctgcactgcctgccggcc
ttccacgacctcggcaccgacatcggccgtgagatccacgcgcggcacgggctgacctcc
ctcgaagtcaccgacgaggtcttcgagtccgcgcactcggtcgtcttcgacgaggcggag
aaccggatgcacaccatcaaggcggtcctggtcgccaccctcgcctga

KEGG   Streptomyces avermitilis: SAVERM_3641
Entry
SAVERM_3641       CDS       T00126                                 

Definition
(GenBank) putative aspartate/ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
sma  Streptomyces avermitilis
Pathway
sma00220  Arginine biosynthesis
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01230  Biosynthesis of amino acids
Module
sma_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    SAVERM_3641
Enzymes [BR:sma01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     SAVERM_3641
SSDB
Motif
Pfam: OTCace_N OTCace
Other DBs
NCBI-ProteinID: BAC71353
NITE: SAV3641
UniProt: Q82H78
Position
complement(4499074..4499997)
AA seq 307 aa
MAPVRHLISIDDLSDTDLYSLVLRGAAFSAGTAGRPAPLAGDVVGIYFRKTSTRTRTAFS
SGALRLGAQIIAYGPDDLQLNTGETSEDTGRVMSGMLDVLVARTAGDPAEMRAWAAQDRM
AVVNAMSADEHPTQALTDLTTLQGHFGGIEGLRVLYVGEGNNTASALALALTRYPGVSLE
LRTPPGYGLAPYYRERAADQAGRHGATFRERHDMDDLPADQDAVYTSRWQTTGTSKPDPD
WREIFAPFQVSAALWETSPKAVFLHDLPAHRGDEVTAEVLDGPASIAFAQAENKMHSAMA
VLEWCRP
NT seq 924 nt   +upstreamnt  +downstreamnt
gtggcacccgtacggcatctgatctccatcgacgacctctccgacaccgacctgtactcc
ctcgtactccgtggcgccgccttctcggccggtaccgcgggccgccccgcgccgctggcc
ggggacgtcgtcggcatctacttccgcaagacgtcgacccgcacccgcaccgccttctcc
agcggagctctgcgactgggggcgcagatcatcgcgtacggccccgacgacctccagctc
aacaccggcgagaccagcgaggacaccggacgggtcatgtccggcatgctcgacgtcctg
gtcgcccggaccgccggcgaccccgccgagatgcgggcctgggccgcgcaggaccggatg
gcggtcgtcaacgcgatgagcgcggacgagcaccccacccaggcactgaccgacctgacc
accctgcaagggcacttcggcggcatcgaggggctgcgggtgctgtacgtgggcgagggc
aacaacaccgcgtcggcgctggcgctcgcactgactcgctatccgggcgtctccctcgaa
ctgcgcacgccgccgggctacgggctggccccgtactaccgcgaacgcgccgccgaccag
gccggccgccacggcgccacgttccgcgagcggcacgacatggacgacctgcccgccgat
caggacgccgtctacacctcccgctggcagaccaccggcaccagcaagccggacccggac
tggcgggagatcttcgccccgttccaggtgtcggcggcactgtgggagaccagtcccaag
gcggtcttcctgcacgacctgcccgcgcaccgcggtgacgaggtcaccgccgaggtgctg
gacggcccggcgagcatcgccttcgcgcaggcggagaacaagatgcacagcgcgatggcg
gtgctggagtggtgcaggccgtga

DBGET integrated database retrieval system