KEGG   Streptomyces avermitilis: SAVERM_2320
Entry
SAVERM_2320       CDS       T00126                                 

Gene name
arcA
Definition
(GenBank) putative arginine deiminase
  KO
K01478  arginine deiminase [EC:3.5.3.6]
Organism
sma  Streptomyces avermitilis
Pathway
sma00220  Arginine biosynthesis
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    SAVERM_2320 (arcA)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.6  arginine deiminase
     SAVERM_2320 (arcA)
SSDB
Motif
Pfam: Amidinotransf
Other DBs
NCBI-ProteinID: BAC70031
NITE: SAV2320
UniProt: Q82KQ3
Position
complement(2824044..2825273)
AA seq 409 aa
MGLHVDSEAGRLRRVILHRPDLELKRLTPSNKDALLFDDVLWVRRARAEHDGFADVLRDR
GVAVHLFGDLLTEALDIPAARTLVLDRVFDEKEYGPLATDHLRAAFETLPAPDLAAALVG
GMTKREFLEAHPEPVSVRFHVMDLDDFLLGPLPNHLFTRDTSAWIYDGVSINAMRWPARQ
RETVHFEAIYRHHPLFRDEAFHVWSEGQADYPCTIEGGDVLVIGNGAVLIGMSERTTPQA
VEMLAHKLFAAGSARTIVALDMPKRRAFMHLDTVMTMVDGDTFTQYAGLGMLRSYTIEPG
VGEKELKVTDHPPEHMHRAIAAALGLGEIRVLTATQDVHAAEREQWDDGCNVLAVEPGVV
VAYERNSTTNTHLRKQGIEVIEIPGSELGRGRGGPRCMSCPVERDAVPG
NT seq 1230 nt   +upstreamnt  +downstreamnt
atgggactgcatgtcgactccgaagccgggcggctgcgccgcgtcatcctgcaccggcct
gatctcgagctcaaaaggctcacccccagcaacaaggacgccctcctcttcgacgacgtg
ctgtgggtgcgccgggcccgcgcggagcacgacgggttcgcggacgtgctgcgcgaccgc
ggtgtcgccgtccacctcttcggcgacctgctcaccgaggcgctggacatcccggccgcc
aggacgctcgtgctggaccgggtcttcgacgagaaggagtacgggccgctcgccaccgac
catctgcgggccgccttcgagaccctgcccgccccggacctggccgccgcgctggtcggc
ggcatgaccaagcgggagttcctggaggcgcaccccgagcccgtctccgtgcgcttccat
gtgatggacctcgacgacttcctgctcggtccgctgcccaaccacctcttcacccgggac
acctccgcctggatctacgacggggtctccatcaacgccatgcgctggcccgcgcggcag
cgtgaaaccgtgcacttcgaggcgatctaccggcaccacccgctcttccgggacgaggcc
ttccatgtctggtccgaagggcaggcggactacccctgcaccatcgagggcggggacgtc
ctcgtcatcggcaacggcgccgtgctcatcggcatgagcgagcggacgacgccgcaggcc
gtcgagatgctcgcgcacaagctgttcgcggccgggtccgcgcgcaccatcgtggcgctc
gacatgcccaagcggcgggcgttcatgcacctggacaccgtgatgacgatggtcgacggc
gacaccttcacccagtacgcggggctcggcatgctccgctcgtacaccatcgagccgggc
gtcggggagaaggagctgaaggtcaccgaccacccgccggagcacatgcaccgcgcgatc
gccgccgcgctcgggctcggtgagatccgcgtcctgaccgccacgcaggacgtgcacgcg
gccgagcgcgaacagtgggacgacggctgcaacgtcctcgcggtcgagccgggcgtcgtg
gtcgcgtacgagcgcaactcgaccaccaacacgcatctgcgcaagcagggcatcgaggtg
atagagatcccgggcagcgaactggggcgggggcgcggcgggccgcgctgtatgagctgt
ccggtggagcgggacgccgtgcccgggtag

DBGET integrated database retrieval system