KEGG   Streptomyces avermitilis: SAVERM_2373Help
Entry
SAVERM_2373       CDS       T00126                                 

Gene name
pks9-1
Definition
(GenBank) putative acyl carrier protein
  KO
K05553  minimal PKS acyl carrier protein
Organism
sma  Streptomyces avermitilis
Pathway
sma00253  Tetracycline biosynthesis
sma01056  Biosynthesis of type II polyketide backbone
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
Module
sma_M00778  Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01056 Biosynthesis of type II polyketide backbone
    SAVERM_2373 (pks9-1)
   00253 Tetracycline biosynthesis
    SAVERM_2373 (pks9-1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sma01004]
    SAVERM_2373 (pks9-1)
   01008 Polyketide biosynthesis proteins [BR:sma01008]
    SAVERM_2373 (pks9-1)
Lipid biosynthesis proteins [BR:sma01004]
 Polyketide synthase
  Component type
   SAVERM_2373 (pks9-1)
Polyketide biosynthesis proteins [BR:sma01008]
 Polyketide synthase (PKS)
  Type II PKS
   C7-C12 cyclized polyketide type
    Octaketide PKS
     SAVERM_2373 (pks9-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PP-binding
Motif
Other DBs
NCBI-ProteinID: BAC70084
NITE: SAV2373
UniProt: Q79ZF7
Position
complement(2897395..2897655)
Genome map
AA seq 86 aa AA seqDB search
MATFTQADLVGYIRQAAGEDEGFDLDGDIADITFADMGYDSVAMVEVTLLVERELGIGLP
DDDKASKNSTPKQFVELVNELLPASI
NT seq 261 nt NT seq  +upstreamnt  +downstreamnt
atggcgactttcactcaggcggacctggtggggtacatacgccaggcggccggcgaggac
gagggattcgacctggacggcgatatcgccgacatcacgttcgccgatatgggctatgac
tcggtcgcgatggtggaggtgacgctcctggtcgagcgtgaactcggcatcggcctgccc
gatgacgacaaggcgagcaagaactcgaccccgaagcagttcgtcgaactggtcaacgag
ctgctgcccgcgtcgatctag

DBGET integrated database retrieval system