KEGG   Streptomyces avermitilis: SAVERM_2375Help
Entry
SAVERM_2375       CDS       T00126                                 

Gene name
pks9-3
Definition
(GenBank) putative 3-oxoacyl-ACP synthase II (probably chain length factor)
  KO
K05552  minimal PKS chain-length factor (CLF/KS beta) [EC:2.3.1.- 2.3.1.260 2.3.1.235]
Organism
sma  Streptomyces avermitilis
Pathway
sma00253  Tetracycline biosynthesis
sma01056  Biosynthesis of type II polyketide backbone
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
Module
sma_M00778  Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01056 Biosynthesis of type II polyketide backbone
    SAVERM_2375 (pks9-3)
   00253 Tetracycline biosynthesis
    SAVERM_2375 (pks9-3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sma01004]
    SAVERM_2375 (pks9-3)
   01008 Polyketide biosynthesis proteins [BR:sma01008]
    SAVERM_2375 (pks9-3)
Enzymes [BR:sma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.235  tetracenomycin F2 synthase
     SAVERM_2375 (pks9-3)
    2.3.1.260  tetracycline polyketide synthase
     SAVERM_2375 (pks9-3)
    2.3.1.-  
     SAVERM_2375 (pks9-3)
Lipid biosynthesis proteins [BR:sma01004]
 Polyketide synthase
  Component type
   SAVERM_2375 (pks9-3)
Polyketide biosynthesis proteins [BR:sma01008]
 Polyketide synthase (PKS)
  Type II PKS
   C7-C12 cyclized polyketide type
    Octaketide PKS
     SAVERM_2375 (pks9-3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C
Motif
Other DBs
NCBI-ProteinID: BAC70086
NITE: SAV2375
UniProt: Q79ZF5
Position
complement(2899008..2900258)
Genome map
AA seq 416 aa AA seqDB search
MSRAVPENDNGTTPERPRAVITGLGVVAPNGFDTDEYWDAVLHGRGGIDRVTRFDPEQYP
ATLAGEVADYDVRAYIPGRLVPQTDQTTRLVLMAADAAVRDSSLDPAALPEDQVGIVTGL
SAGGLEYSQRELEKLWSLGSDHVSAYLSFSWFYAVNTGQISIRHGWHGPGGVLTGNTSGL
DAIAQARRHVVDGLPVVMCGAVESAMCPLGWTIELTTGRMSTVADRTQAYLPFDTAASGY
VPGEGGAMVVVEEAGHARGRGARPYSEIAGYATTFDPRPGSAREPGLRRAIESALADAGV
TPDEVDVVFADAAGVGELDRAEAAAVTAVFGPRGVPVTAPKTMTGRLYSGGPALDVATAS
LSMRHGVIPPMINVTDPVRSDQLDLVLDRPRETTVSTALVLARSDGINSAVVLTAA
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgagtagggcagtcccggagaacgacaacggcacgacgccggagcgtcctcgtgcggtg
atcaccggtctcggggtggtcgcgccgaacgggttcgacaccgacgagtactgggacgcc
gtcctccatgggcggggcggcatcgaccgggtcacccgcttcgatccggagcagtacccg
gccacactggcgggcgaggtggccgactacgacgtgcgcgcgtacatccccggacgtctg
gtgccgcagaccgaccagaccacccggctggtgctgatggcggcggacgccgctgtccgg
gactcctcgctcgatccggccgcgctcccggaggaccaggtcggcatcgtcaccggtctc
tccgcgggcggcctcgagtacagccagcgcgagctggagaagctctggagcctcggcagc
gaccatgtgagcgcctatctctcgttctcgtggttctacgcggtgaacacgggtcagatt
tccatccggcacgggtggcacggccccggcggcgtcctgaccgggaacaccagcggcctg
gacgccatagcgcaggcccgccggcacgtggtcgacggcctgccggtggtgatgtgcggc
gccgtggagagcgcgatgtgcccgctcgggtggacgatcgagctgaccaccggccggatg
agcacggtcgccgaccggacccaggcctacctgccgttcgacaccgccgcgtccggctac
gtacccggagagggcggcgccatggtcgtcgtcgaggaggccggacacgcgcgcggccga
ggcgcccggccgtacagcgagatcgccgggtacgccaccaccttcgacccgcggcccggt
tcggcacgggagcccgggctgcgccgggcgatcgagtccgcgctggcggacgccggtgtg
acgcccgacgaggtcgacgtcgtgttcgcggacgcggccggggtcggcgaactcgaccgc
gcggaagccgccgccgtcaccgccgtgttcggtccacggggtgttccggtgaccgcgccg
aagacgatgaccggccggctgtactccggtggcccggcgctcgacgtggccacggcgtcg
ttgagcatgcggcacggcgtcatcccgccgatgatcaatgtgaccgaccccgtccggtcc
gaccagctcgacctggtgctcgaccgaccgagggagacgaccgtgtccaccgctctggta
ctggcccgcagcgacggcatcaactccgcggtggtgctgacggcggcatga

DBGET integrated database retrieval system