KEGG   Streptomyces avermitilis: SAVERM_2453Help
Entry
SAVERM_2453       CDS       T00126                                 

Gene name
rnhB
Definition
(GenBank) putative ribonuclease HII
  KO
K03470  ribonuclease HII [EC:3.1.26.4]
Organism
sma  Streptomyces avermitilis
Pathway
sma03030  DNA replication
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SAVERM_2453 (rnhB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sma03032]
    SAVERM_2453 (rnhB)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.4  ribonuclease H
     SAVERM_2453 (rnhB)
DNA replication proteins [BR:sma03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    RNase H
     SAVERM_2453 (rnhB)
   Elongation factors (archaeal)
     SAVERM_2453 (rnhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNase_HII
Motif
Other DBs
NCBI-ProteinID: BAC70164
NITE: SAV2453
UniProt: Q82KF0
Position
complement(2991649..2992350)
Genome map
AA seq 233 aa AA seqDB search
MPYEPPTHTVERSLRATTGAKVIAGVDEVGRGAWAGPVTVCAAITGLRRPPEGLTDSKLL
TVKRRTVLAEELRKWVTSYALGHASPEEIDALGMTAALRLAAVRALEALPVRPDAVILDG
KHDYLGSPWKVRTVIKGDQSCVAVAAASVIAKVQRDKMMAELGIEHADFGFAANAGYPSP
VHKAALAERGPTPYHRLSWAYLDALPQWRHLKKVRSWADGSVPEIEGQLGFDF
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgccgtacgaaccacccactcacaccgtcgagcgctccctccgcgcaacgaccggagcg
aaggtcattgccggtgtcgacgaggtggggcgcggcgcgtgggccgggcccgtcaccgtc
tgcgcggcgatcaccggactgcgccggcctcccgaaggcctcaccgactccaagctgctg
accgtcaagcgacgcactgtgctcgccgaggagctgcggaagtgggtgacctcgtacgct
ctggggcacgcctctcccgaggagatcgacgccctggggatgacggccgcgctgcgactc
gccgccgtacgcgccctggaggccttgccggtccgtcccgacgcggtcattctcgacggg
aagcacgactatctcgggtcgccctggaaggttcgtacggtgatcaagggtgaccagtcc
tgcgtggccgttgcggcggcctcggtgatcgccaaggtgcagcgcgacaaaatgatggcc
gaactgggcatcgaacatgcagacttcggttttgcggccaacgccgggtatccgtcaccg
gtgcacaaggccgcgctggcggagcggggccccaccccgtaccaccggctgtcgtgggcg
tatcttgatgcgctgccccagtggcggcacctcaagaaggtccgcagctgggcggacgga
agcgttccggaaatcgagggccagctcggcttcgatttctga

DBGET integrated database retrieval system