KEGG   Streptomyces avermitilis: SAVERM_2501Help
Entry
SAVERM_2501       CDS       T00126                                 

Gene name
nei1
Definition
(GenBank) putative endonuclease VIII and DNA N-glycosylase with an AP lyase activity
  KO
K05522  endonuclease VIII [EC:3.2.2.- 4.2.99.18]
Organism
sma  Streptomyces avermitilis
Pathway
sma03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    SAVERM_2501 (nei1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sma03400]
    SAVERM_2501 (nei1)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     SAVERM_2501 (nei1)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     SAVERM_2501 (nei1)
DNA repair and recombination proteins [BR:sma03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     SAVERM_2501 (nei1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fapy_DNA_glyco H2TH zf-FPG_IleRS Nudix_N_2
Motif
Other DBs
NCBI-ProteinID: BAC70212
NITE: SAV2501
UniProt: Q82KA2
Position
3052491..3053333
Genome map
AA seq 280 aa AA seqDB search
MPEGDTVYQAARRLHSALAGKVLTRSDLRVPKFATADLTGRTVLDVTPRGKHLLTRIEGG
LTLHSHLRMDGSWKVYAPGQRWSGGPAHQIRAIFGTADRTSVGYRLPVLELLRTADEHRA
VGHLGPDLLGPDWDPDRARENLLRDPARPLGEALLDQRNLAGIGNVYKSELCFLLRATPW
LPVGDLPAEHLAQLPALAKKLLETNRDRPARSTTGRREQRLFVYGRAPRPCLRCGTPVRV
ADQGDGSRERPTYWCPACQPGPTPAPGAHARRPSRPRITN
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaaggcgacaccgtctaccaagccgcgaggcgtctgcacagcgccctcgcgggc
aaggtactgacccgttccgacctccgggtgccgaaattcgccacggccgacctcaccggc
cgcaccgtactggacgtcaccccccgcggaaagcacctcctcacccgcatcgagggcggc
ctcaccctgcactcccatctgcggatggacggttcctggaaggtgtacgcgccgggccag
cgctggagcggcggccccgcacaccagatccgggcgatcttcggcaccgcggaccgcacg
tccgtgggctaccgcctccccgtcctcgaactgctccgcaccgccgacgaacaccgcgcc
gtcggccatctgggccccgacctcctgggccccgactgggaccccgaccgggctcgggag
aacctcctccgcgacccggcccgccccctcggcgaggccctcctcgatcagcgcaacctc
gccggcatcggcaatgtctacaagagcgagctgtgcttcctgctccgggccactccatgg
ctccccgtcggtgacctcccggccgagcacctcgcccaactccccgccctcgccaagaaa
ctcctggagaccaaccgcgaccgcccggcgcgcagcaccacgggccgccgcgagcagagg
ctcttcgtgtacggccgcgcaccccgcccctgtctgcgctgcggcacccccgtccgggtg
gccgaccagggcgacggttcccgcgagcgccccacctactggtgcccggcctgccagccg
gggcccactccggccccgggcgcccacgcacgaaggccaagccggccacgtatcactaat
tga

KEGG   Streptomyces avermitilis: SAVERM_5427Help
Entry
SAVERM_5427       CDS       T00126                                 

Gene name
nei2
Definition
(GenBank) putative endonuclease VIII and DNA N-glycosylase with an AP lyase activity
  KO
K05522  endonuclease VIII [EC:3.2.2.- 4.2.99.18]
Organism
sma  Streptomyces avermitilis
Pathway
sma03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    SAVERM_5427 (nei2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sma03400]
    SAVERM_5427 (nei2)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     SAVERM_5427 (nei2)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     SAVERM_5427 (nei2)
DNA repair and recombination proteins [BR:sma03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     SAVERM_5427 (nei2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: H2TH Fapy_DNA_glyco zf-FPG_IleRS FbpA
Motif
Other DBs
NCBI-ProteinID: BAC73139
NITE: SAV5427
UniProt: Q82CC4
Position
6580410..6581219
Genome map
AA seq 269 aa AA seqDB search
MPEGHTIHRLADDYEARFGGAAARVTSPQGKFADAAALLDGTVLETADAHGKHLFLGFRR
ADWIHIHLGLFGKVGFGDAPAPPPTDTVRLRLANDTSYVDLRGPTTCALITDGEKRAIHD
RLGPDPLRPDADPARAYDRVSRSRTSVAALLMDQKVIAGVGNVYRAEVLFRHGIDPYRTG
RELTRREWDAIWADLVALMREGVRNNRIDTVRPEHTPEAMGRPPRVDDHGGEVYVYRRAN
LPCHICGGEIRTAGLAARNLFWCPTCQQA
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgaggggcacacgattcaccgcctggccgacgactacgaagccaggttcggcggc
gcggccgcacgcgtgaccagcccgcagggcaagttcgccgacgccgccgccctcctggac
ggcacggtcctcgaaacggcggacgcccacggcaagcacctcttcctcggcttccgccgg
gccgactggatccacatccacctcggcctcttcggcaaggtcggcttcggcgacgcaccc
gccccgccccccacggacaccgtccggctgcgcctcgcgaacgacacgtcgtacgtcgac
ctgcgcggccccacgacctgcgccctgatcaccgacggcgagaagcgcgcgatacacgac
cgcctcggccccgacccgctgcggcccgacgccgacccggcccgcgcgtacgaccgtgtc
tcccgcagccgtacgagcgtcgccgccctgctcatggaccagaaggtcatcgcgggcgtc
ggcaacgtctaccgcgccgaggttctcttccggcacggcatcgacccgtaccgcacgggc
agggagctcacccgccgcgaatgggacgcgatctgggcggacctcgtcgcgctcatgcgc
gagggcgtccgcaacaaccgcatcgacaccgtccggcccgagcacacccccgaggccatg
ggccgcccgccgcgcgtggacgatcacggcggcgaggtctacgtgtaccgcagggccaac
ctgccctgccacatctgtggcggcgagatccgcaccgccggtctcgccgcccgcaacctg
ttctggtgcccgacctgccaacaggcgtga

DBGET integrated database retrieval system