KEGG   Streptomyces avermitilis: SAVERM_2517Help
Entry
SAVERM_2517       CDS       T00126                                 

Gene name
thyX
Definition
(GenBank) putative thymidylate synthase
  KO
K03465  thymidylate synthase (FAD) [EC:2.1.1.148]
Organism
sma  Streptomyces avermitilis
Pathway
sma00240  Pyrimidine metabolism
sma00670  One carbon pool by folate
sma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    SAVERM_2517 (thyX)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SAVERM_2517 (thyX)
Enzymes [BR:sma01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.148  thymidylate synthase (FAD)
     SAVERM_2517 (thyX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thy1
Motif
Other DBs
NCBI-ProteinID: BAC70228
NITE: SAV2517
UniProt: Q82K86
Position
complement(3082295..3083035)
Genome map
AA seq 246 aa AA seqDB search
MTDTPADDLKPSFRSDVTVELVKHSAADSDVLWAARVSTAGEQSLDELKKDPERSKGLIN
YLMRDRHGSPFEHNSMTFFISAPIFVFREFMRHRVGWSYNEESGRYRELEPVFYVPGESR
KLVQEGRPGKYVFVEGTQAQQELTGRVMEDSYRQAYEAYQEMLAAGVAREVARAVLPVGL
FSSMYATCNARSLMHFLGLRTQHELAKVPSFPQREIEMVGEKMEAEWAKLMPLTYAAFNT
NGRVAP
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacacccccgccgacgacctcaagcccagcttccgcagcgacgtcaccgtcgag
ttggtgaagcacagcgcggccgactcggacgtgctgtgggccgcccgcgtctccaccgcc
ggcgagcagtccctggacgagctgaagaaggacccggagcgctcgaagggcctgatcaac
tacctgatgcgggaccggcacggcagccccttcgagcacaactcgatgacgttcttcatc
agcgcccccatcttcgtgttccgcgagttcatgcgacaccgggtgggctggtcgtacaac
gaggagtcgggccggtacagggagctcgagccggtcttctacgtcccgggggagtcccgc
aagctggtccaggagggccgccccggcaagtacgtcttcgtcgagggcacccaggcacag
caggagctcacgggccgcgtcatggaggactcgtaccgtcaggcgtacgaggcctaccag
gagatgctcgccgccggcgtcgcccgcgaggtcgcccgcgcggtcctccccgtcggcctc
ttctcctcgatgtacgccacgtgcaacgcccgctcgctgatgcacttcctcggcctgcgc
acccagcacgagctggccaaggtgccgtccttcccgcagcgggagatcgagatggtcggc
gagaagatggaggcggagtgggccaagctcatgccgctgacgtacgcggccttcaacacg
aacgggcgcgtggcgccgtaa

DBGET integrated database retrieval system