KEGG   Streptomyces avermitilis: SAVERM_2583
Entry
SAVERM_2583       CDS       T00126                                 

Gene name
gabT
Definition
(GenBank) putative 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
sma  Streptomyces avermitilis
Pathway
sma00250  Alanine, aspartate and glutamate metabolism
sma00280  Valine, leucine and isoleucine degradation
sma00310  Lysine degradation
sma00410  beta-Alanine metabolism
sma00640  Propanoate metabolism
sma00650  Butanoate metabolism
sma01100  Metabolic pathways
sma01120  Microbial metabolism in diverse environments
Module
sma_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SAVERM_2583 (gabT)
   00650 Butanoate metabolism
    SAVERM_2583 (gabT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SAVERM_2583 (gabT)
   00280 Valine, leucine and isoleucine degradation
    SAVERM_2583 (gabT)
   00310 Lysine degradation
    SAVERM_2583 (gabT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SAVERM_2583 (gabT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sma01007]
    SAVERM_2583 (gabT)
Enzymes [BR:sma01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SAVERM_2583 (gabT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     SAVERM_2583 (gabT)
    2.6.1.48  5-aminovalerate transaminase
     SAVERM_2583 (gabT)
Amino acid related enzymes [BR:sma01007]
 Aminotransferase (transaminase)
  Class III
   SAVERM_2583 (gabT)
SSDB
Motif
Pfam: Aminotran_3 Aminotran_1_2 Ligase_CoA
Other DBs
NCBI-ProteinID: BAC70294
NITE: SAV2583
UniProt: Q82K21
Position
3175462..3176796
AA seq 444 aa
MSALPQERRVVTAIPGPKSQELQARRTAVVAAGVGSVLPVFTTRAGGGIIEDVDGNRLID
FGSGIAVTSVGASAEAVVRRASAQLQDFTHTCFMVTPYEGYVAVAEALAELTPGDHAKKS
ALFNSGAEAVENAVKIARAYTKRQAVVVFDHGYHGRTNLTMALTAKNMPYKNGFGPFAPE
VYRVPVAYGYRWLTGPENAGAEASAQAIDMINKQIGADNVAAIIIEPVLGEGGFIEPAKG
FLPAISKFAKDNGIVFVADEIQSGFCRTGQWFACEDEGIVPDLITTAKGIAGGLPLAAVT
GRAEIMDAAHAGGLGGTYGGNPVACAGALGAIETMKELDLNAKAKNIEAVMKARLGAMAE
KFDIIGDVRGRGGMIAIELVKDRDTKEPNPEAAGALAKACHQEGLLVLTCGTYGNVLRFL
PPLVIGEDLLNEGLDIIEQAFSRI
NT seq 1335 nt   +upstreamnt  +downstreamnt
atgagcgcacttccgcaggagcgccgcgtcgtcaccgccatccccggcccgaagtcgcag
gagctgcaggcccgccgtaccgccgtggtcgcggccggtgtgggttcggtgctgccggtc
ttcaccacgcgcgccggcggcggcatcatcgaggacgtcgacggcaaccgcctgatcgac
ttcggctccggcatcgcggtgacgtccgtgggcgcctccgccgaggccgtcgtacgccgc
gcctccgcccagctccaggacttcacgcacacctgtttcatggtcacgccgtacgagggc
tacgtcgccgtcgccgaggcgctggccgagctcacgccgggtgaccacgccaagaagtcg
gccctgttcaactcgggcgccgaggccgtcgagaacgccgtcaagatcgcccgcgcgtac
accaagcgccaggcggtcgtcgtgttcgaccacggctaccacggccgtacgaacctcacg
atggcgctgaccgcgaagaacatgccgtacaagaacggcttcggaccgttcgcgcccgag
gtctaccgggtgccggtggcgtacggctaccgctggctgaccggcccggagaacgccggt
gccgaggcctccgcccaggcgatcgacatgatcaacaagcagatcggcgccgacaacgtc
gccgcgatcatcatcgagccggtgctcggcgagggcggcttcatcgagcccgcgaagggc
ttcctccccgccatcagcaagttcgccaaggacaacggcatcgtcttcgtcgccgacgag
atccagtccggcttctgccgcaccggccagtggttcgcgtgcgaggacgagggcatcgtc
ccggacctgatcacgaccgccaagggcatcgcgggcggtctgccgctcgccgccgtcacc
ggccgcgccgagatcatggacgccgcgcacgcgggcggcctgggcggcacctacggcggc
aacccggtcgcctgcgcgggtgcgctcggcgcgatcgagacgatgaaggagctcgacctc
aacgccaaggcgaagaacatcgaggccgtcatgaaggcccgcctgggtgccatggccgag
aagttcgacatcatcggcgacgtccgcggccgtggcgggatgatcgcgatcgagctggtc
aaggaccgcgacaccaaggagccgaacccggaggcggccggcgcgctcgccaaggcgtgc
caccaggagggcctgctggtcctgacctgtggcacctacggcaacgtgctgcgcttcctg
cctccgctggtcatcggcgaggacctgctgaacgagggcctcgacatcattgagcaggcg
ttctcccgtatctga

DBGET integrated database retrieval system