KEGG   Streptomyces avermitilis: SAVERM_2648Help
Entry
SAVERM_2648       CDS       T00126                                 

Gene name
ffh
Definition
(GenBank) putative signal recognition particle, subunit SRP54
  KO
K03106  signal recognition particle subunit SRP54 [EC:3.6.5.4]
Organism
sma  Streptomyces avermitilis
Pathway
sma02024  Quorum sensing
sma03060  Protein export
sma03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    SAVERM_2648 (ffh)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SAVERM_2648 (ffh)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SAVERM_2648 (ffh)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sma02044]
    SAVERM_2648 (ffh)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.4  signal-recognition-particle GTPase
     SAVERM_2648 (ffh)
Secretion system [BR:sma02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   SAVERM_2648 (ffh)
  Eukaryotic Sec-SRP protein
   SAVERM_2648 (ffh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SRP54 SRP_SPB SRP54_N Zeta_toxin CbiA cobW APS_kinase AAA_18 AAA_30 AAA_33 MMR_HSR1 AAA_16 Mei5 MeaB AAA Thymidylate_kin NTPase_1 AAA_25 TsaE MobB AAA_22 ArsA_ATPase AAA_31 ATP_bind_1 6PF2K AAA_17
Motif
Other DBs
NCBI-ProteinID: BAC70359
NITE: SAV2648
UniProt: Q82JV6
Position
complement(3244452..3246002)
Genome map
AA seq 516 aa AA seqDB search
MFDTLSDRLSATFKNLRGKGRLSEADIDATAREIRIALLEADVALPVVRTFIKNVKERAL
GSEVSKALNPAQQVLKIVNEELVTILGGETRRLRFAKNPPTVIMLAGLQGAGKTTLAGKL
GKHLKDQGHSPILVAADLQRPNAVNQLSVVAERAGVAVYAPEPGNGVGDPVKVAKDSIEF
AKTKVHDIVIVDTAGRLGIDQELMQQAADIRDAVSPDEILFVVDAMIGQDAVNTAEAFRD
GVGFDGVVLSKLDGDARGGAALSIASVTGKPIMFASNGEKLDDFDAFHPDRMASRILDMG
DLLTLIEQAEKTFSQEEAEKMASKLASKKGQDFTLDDFLSQMEQVRKMGSISKLLGMLPG
MGQIKDQINNLDERDVDRTAAIIKSMTPAERQEPTIINGSRRARIAKGSGVDVSAVKGLV
ERFFEARKMMSRMAQGGGMPGMPGMPGMGGGPGRQKKKQKQAKGKQRSGNPMKRRQQELE
EAARKEAADQGGNAFGLPQQGGQDFELPDEFKKFMG
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
gtgttcgatactctctccgatcgcctctcagccactttcaagaacctgcggggcaaggga
cggttgtccgaggcggacatcgacgccacggcccgcgagatccgtatcgcgctcctcgag
gcggacgtggccctgccggtcgtccggaccttcatcaagaacgtcaaggagcgcgccctc
ggctccgaggtctccaaggcgctgaacccggcccagcaggtcctgaagatcgtgaacgag
gaactcgtcacgatcctcggcggcgagacgcgacgcctcaggttcgccaagaacccgccc
accgtgatcatgctcgcgggtctgcagggtgccggtaagaccacgctcgccggaaagctc
ggcaagcacctcaaggaccagggccactccccgatcctcgtcgccgccgacctccagcgc
ccgaacgcggtcaaccagctcagcgtcgtcgccgagcgcgccggcgtcgcggtctacgcg
cccgagccgggcaacggcgtgggtgacccggtcaaggtcgccaaggactccatcgagttc
gcgaagaccaaggtccacgacatcgtgatcgtggacaccgcgggccgcctcggcatcgac
caggaactgatgcagcaggccgcggacatccgtgacgcggtctcgccggacgagatcctc
ttcgtcgtcgacgcgatgatcggtcaggacgcggtcaacaccgcggaggccttccgtgac
ggtgtcggtttcgacggcgtggtcctgtcgaagctcgacggcgacgcccgcggtggcgcc
gccctgtcgatcgcctcggtcaccggcaagccgatcatgttcgcgtcgaacggcgagaag
ctcgacgacttcgacgccttccacccggaccggatggcctcccgcatcctcgacatgggt
gacctgctcaccctgatcgagcaggcggagaagacgttcagccaagaagaggccgagaag
atggcctcgaagctggcgtccaagaagggccaggacttcacgctcgacgacttcctgtcc
cagatggagcaggtccggaagatgggcagcatcagcaagctgctcggcatgctgcccggc
atgggccagatcaaggaccagatcaacaacctcgacgagcgcgacgtcgaccgcacggcc
gcgatcatcaagtcgatgaccccggccgagcgccaggagccgacgatcatcaacggctcg
cgccgcgcccgtatcgccaagggttccggcgtcgacgtcagcgcggtcaagggcctggtc
gagcggttcttcgaggcccgcaagatgatgtcccgcatggcccagggcggcggtatgccg
ggtatgcccgggatgccgggcatgggtggcggccccggccggcagaagaagaagcagaag
caggccaagggcaagcagcgctcgggcaacccgatgaagcgcaggcagcaggagctggag
gaggccgcccgcaaggaggccgcggaccagggcggcaacgcgttcggcctgccccagcag
ggcggccaggacttcgagctgccggacgagttcaagaagttcatgggctga

DBGET integrated database retrieval system