KEGG   Streptomyces avermitilis: SAVERM_2686
Entry
SAVERM_2686       CDS       T00126                                 

Gene name
leuC
Definition
(GenBank) putative 3-isopropylmalate dehydratase subunit large
  KO
K01703  3-isopropylmalate/(R)-2-methylmalate dehydratase large subunit [EC:4.2.1.33 4.2.1.35]
Organism
sma  Streptomyces avermitilis
Pathway
sma00290  Valine, leucine and isoleucine biosynthesis
sma00660  C5-Branched dibasic acid metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01210  2-Oxocarboxylic acid metabolism
sma01230  Biosynthesis of amino acids
Module
sma_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    SAVERM_2686 (leuC)
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    SAVERM_2686 (leuC)
Enzymes [BR:sma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.33  3-isopropylmalate dehydratase
     SAVERM_2686 (leuC)
    4.2.1.35  (R)-2-methylmalate dehydratase
     SAVERM_2686 (leuC)
SSDB
Motif
Pfam: Aconitase DUF4946
Other DBs
NCBI-ProteinID: BAC70397
NITE: SAV2686
UniProt: Q82JR8
Position
complement(3291564..3292997)
AA seq 477 aa
MGRTLAEKVWDDHVVRRAEGEPDLLFIDLHLLHEVTSPQAFDGLRQAGRPVRRLDLTIAT
EDHNTPTLDIDKPIADPVSRAQLETLRKNCAEFGVRLHSLGDVEQGVVHVVGPQLGLTQP
GTTVVCGDSHTSTHGAFGALAFGIGTSQVEHVLATQTLPLARPKTMAITVDGELPDGVTA
KDLILAIIARIGTGGGQGYILEYRGSAIEKLSMEARMTICNMSIEAGARAGMIAPDETTF
AYLKGRAHAPEGEEWDAAVAYWKTLKSDEDAEFDAEVVIAAAALSPFVTWGTNPGQGAPL
SASVPDPASYEDASERFAAEKALEYMGLTAGQPLRDIKVDTVFVGSCTNGRIEDLRAAAA
IVEGRKVADGVRMLIVPGSARVGLQAVSEGLDVVFKEAGAEWRHAGCSMCLGMNPDQLAP
GERSASTSNRNFEGRQGKGGRTHLVSPQVAAATAVLGHLASPADLADENAARTPAGV
NT seq 1434 nt   +upstreamnt  +downstreamnt
atgggtaggacactcgcggagaaggtctgggacgaccatgtcgtccggcgcgccgagggc
gagcccgacctcctcttcatcgatctgcacctgctgcacgaggtgaccagtccgcaggcc
ttcgacggtctgcgccaggcggggcgtccggtgcgccgtctcgacctcaccatcgccacc
gaggatcacaacaccccgaccctcgacatcgacaagcccatcgcggacccggtctcccgg
gcccagctggagacgctgcgcaagaactgcgccgagttcggcgtgcgcctgcactcgctc
ggcgacgtcgagcagggcgtcgtgcacgtcgtcggcccgcagctgggcctgacccagccc
ggcaccacggtcgtctgcggcgactcccacacctccacgcacggcgccttcggcgcgctg
gcgttcggcatcggcacctcgcaggtcgagcacgtgctggccacccagacgctgccgctg
gcccgccccaagaccatggccatcaccgtcgacggcgagctgcccgacggcgtcaccgcc
aaggacctgatcctggcgatcatcgccaggatcggtaccggcggcggccagggctacatc
ctggaataccgcggctccgccatcgagaagctctcgatggaggcccggatgaccatctgc
aacatgtcgatcgaggccggcgcccgcgcgggcatgatcgcccccgacgagaccaccttc
gcgtacctcaagggccgtgcccacgcgcccgagggcgaggagtgggacgccgccgtcgcg
tactggaagaccctgaagtcggacgaggacgcggaattcgacgccgaggtcgtcatcgcc
gccgccgcgctgtcgccgttcgtcacctggggcaccaaccccggccagggcgcgccgctt
tcggcgtccgtccccgaccccgcttcgtacgaggacgcttcggagcgcttcgccgccgaa
aaggccctggaatacatggggttgaccgccgggcagccgctgcgcgacatcaaggtcgac
accgtcttcgtaggttcgtgcaccaacggccgcatcgaggacctgcgtgcggccgccgcg
atcgtcgagggccgcaaagtcgccgacggcgtacggatgctgatcgtccccggctcggcg
cgggtcggtctccaggccgtctccgagggcctggacgtggtcttcaaggaggccggcgcc
gaatggcggcacgcgggctgctcgatgtgtctgggcatgaaccccgaccagctggccccc
ggtgagcgctccgcgtccacctccaaccgcaacttcgaaggcaggcagggcaagggcggc
cgtacgcacctggtgtcgccgcaggtcgccgccgccaccgccgtgctcggccacctggcc
tccccggccgacctggccgacgagaacgccgcccgtacgcccgctggagtctga

DBGET integrated database retrieval system