KEGG   Streptomyces avermitilis: SAVERM_2710
Entry
SAVERM_2710       CDS       T00126                                 

Gene name
leuA1
Definition
(GenBank) putative 2-isopropylmalate synthase
  KO
K01649  2-isopropylmalate synthase [EC:2.3.3.13]
Organism
sma  Streptomyces avermitilis
Pathway
sma00290  Valine, leucine and isoleucine biosynthesis
sma00620  Pyruvate metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01210  2-Oxocarboxylic acid metabolism
sma01230  Biosynthesis of amino acids
Module
sma_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAVERM_2710 (leuA1)
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    SAVERM_2710 (leuA1)
Enzymes [BR:sma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.13  2-isopropylmalate synthase
     SAVERM_2710 (leuA1)
SSDB
Motif
Pfam: HMGL-like LeuA_dimer HNHc_6 URO-D
Other DBs
NCBI-ProteinID: BAC70421
NITE: SAV2710
UniProt: Q82JP4
Position
complement(3323914..3325518)
AA seq 534 aa
MTETSELDDSFHVFDTTLRDGAQREGINLTVADKLAIARHLDDFGVGFIEGGWPGANPRD
TEFFARAQQEIDFKHAQLVAFGATRRAGAKASEDPQVKALLEAGAQVITLVAKSHDRHVE
LALRTTLDENLEMVRDTVSYLCSQGRRVFVDCEHFFDGYRANPEYAKAVVRAAAEAGADV
VVLCDTNGGMLPAQVQAVVATVLADTGARLGIHAQDDTGCAVANTLAAVDAGATHVQCTA
NGYGERVGNSNLFPVVAALELKYGKKVLPEGALREMTRISHAIAEVVNLTPSTHQPYVGV
SAFAHKAGLHASAIKVDPDLYQHIDPERVGNTMRMLVSDMAGRASIELKGKELGVDISGD
RELVGRVVERVKERELKGYTYEAADASFELLLRAEAEGKARTYFEVESWRAIVEDRPDGT
HANEATVKLFAKGERIVATAEGNGPVNALDRALRVALEMIYPQLAKLELVDYKVRILEGK
HGTSSTTRVLISTSDGTGEWSTVGVAENVIAASWQALEDAYTYGLLRAGVEPAE
NT seq 1605 nt   +upstreamnt  +downstreamnt
atgacggaaaccagcgaactcgacgattcgttccacgtcttcgacacgaccctgcgcgac
ggcgcacagcgcgagggcattaacctcacggtcgccgacaagctggccatcgcacggcac
ctggacgacttcggcgtgggcttcatcgagggcggctggcccggcgccaacccgcgggac
accgagttcttcgcccgcgcccagcaggagatcgacttcaagcacgcccagctggtggcc
ttcggagccacgcgccgcgcgggcgccaaggcgagcgaggacccgcaggtcaaggcgctg
ctggaggcgggcgcccaggtgatcaccctggtcgccaagtcgcacgaccgccatgtcgaa
ctggctctgcgcacgacgctcgacgagaacctggagatggtccgcgacacggtctcgtac
ctgtgctcccaggggcgccgggtcttcgtcgactgtgagcacttcttcgacggttaccgg
gcgaacccggagtacgcgaaggcggtcgtacgggccgcggccgaggccggcgccgatgtg
gtcgtgctctgcgacaccaacggcggcatgctccccgcccaggtccaggcggtcgtcgcc
acggtcctcgcggacaccggtgcccggctcggcatccacgcccaggacgacacgggctgc
gcggtggcgaacacgctggccgcggtggacgcgggcgcgacccatgtgcagtgcacggcg
aacgggtacggcgagcgggtcggcaactccaacctgttcccggtggtggcggccctggag
ctgaagtacggcaagaaggtgctccccgaaggcgcgctgcgcgagatgacgaggatctcg
cacgcgatcgccgaggtcgtgaacctcaccccctccacgcaccagccgtacgtcggtgtc
tcggccttcgcgcacaaggcgggcctgcacgcctccgcgatcaaggtcgacccggacctg
taccagcacatcgaccccgagcgggtcggcaacaccatgcggatgctggtgtccgacatg
gcgggccgcgcctccatcgagctcaagggcaaggagctcggcgtcgacatcagcggcgac
cgcgagctggtcggccgggtcgtggagcgggtgaaggagcgcgagctcaagggctacacg
tacgaggcggcggacgcgagcttcgaactcctgctgcgcgcggaggcggagggcaaggcc
cgcacgtacttcgaggtcgagtcctggcgggcgatcgtcgaggaccgcccggacggcacc
cacgccaacgaggccacggtcaagctcttcgccaagggcgagcggatcgtcgccaccgcc
gagggcaacggcccggtcaacgccctcgaccgggccctgcgcgtcgccctcgaaatgatc
tacccccagctcgccaagctggagctggtggactacaaggtccgcatcctggagggcaag
cacggcacgtcctccacgacccgcgtgctcatctccacctccgacggcaccggtgaatgg
tcgacggtcggtgtcgcggagaacgtgatcgccgcgtcctggcaggccctggaggacgcc
tacacgtacggcctgctgcgggccggcgtggagccggccgagtag

KEGG   Streptomyces avermitilis: SAVERM_5601
Entry
SAVERM_5601       CDS       T00126                                 

Gene name
leuA2
Definition
(GenBank) putative 2-isopropylmalate synthase
  KO
K01649  2-isopropylmalate synthase [EC:2.3.3.13]
Organism
sma  Streptomyces avermitilis
Pathway
sma00290  Valine, leucine and isoleucine biosynthesis
sma00620  Pyruvate metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01210  2-Oxocarboxylic acid metabolism
sma01230  Biosynthesis of amino acids
Module
sma_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAVERM_5601 (leuA2)
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    SAVERM_5601 (leuA2)
Enzymes [BR:sma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.13  2-isopropylmalate synthase
     SAVERM_5601 (leuA2)
SSDB
Motif
Pfam: HMGL-like LeuA_dimer
Other DBs
NCBI-ProteinID: BAC73313
NITE: SAV5601
UniProt: Q82BV3
Position
6774328..6776049
AA seq 573 aa
MANRQQPTSMPIHKYRPYEQVDIADRTWPDNRVTVAPRWLSTDLRDGNQALIDPMSPARK
REMFDLLVKMGYKEIEVGFPASGQTDFDFVRSIIEDETAIPDDVTISVLTQAREDLIERT
VESLVGAKRATVHLYNATAPVFRRVVFRGSKDQIKQIAVDGTRLVVEYAEKLLDERTTFG
YQYSPEIFTDTELDFALEVCEAVMDVWQPGPDREIILNLPATVERSTPSTHADRFEWMSR
NLSRREYVCLSVHPHNDRGTAVAAAELALMAGADRIEGCLFGQGERTGNVDLVTLGMNLF
SQGVDPQIDFSNIDEVRRTAEYCNQMEVHARHPYVGDLVYTSFSGSHQDAIKKGFDAMEA
DAAAKGVTVDDIEWAVPYLPIDPKDVGRSYEAVIRVNSQSGKGGIAYVLKNDHKLDLPRR
MQIEFSKIIQTKTDAEGGEVTPKDIWAVFQDEYLPNPRNPWGRIQVKTGQTTTDKDGVDT
LTVEASVDGVDTVLTGSGNGPISAFFDALQSVGIDVRLLDYTEHTMSEGASAQAASYIEC
AIDGQVLWGIGIDANTTRASLKAVVSAVNRAAR
NT seq 1722 nt   +upstreamnt  +downstreamnt
atggcgaaccgccagcagcccacgtccatgccgatccacaagtaccgcccgtacgagcag
gtcgacatcgccgaccgcacgtggccggacaaccgggtcaccgtcgctccgcgctggctc
tccaccgacctgcgcgacggcaaccaggccctgatcgaccccatgtcgcccgcccgcaag
cgcgagatgttcgacctgctggtgaagatgggctacaaggagatcgaggtcggtttcccc
gcctccgggcagacggacttcgacttcgtgcggtcgatcatcgaggacgagaccgcgatt
cccgacgacgtcacgatctccgtactgacccaggcccgcgaggacctgatcgagcggacc
gtggagtccctggtcggcgccaagcgcgccaccgtgcacctgtacaacgcgacggccccc
gtcttccggcgggtcgtcttccgcggctccaaggaccagatcaagcagatcgccgtcgac
ggcacccggctggtcgtggagtacgcggagaagctgctggacgagcgcaccacgttcggc
taccagtacagccccgagatcttcaccgacaccgagctggacttcgccctggaggtctgc
gaggccgtcatggacgtctggcagcccggaccggaccgcgagatcatcctcaacctgcct
gccaccgtcgagcgctcgacgccgtcgacgcacgcggaccgcttcgagtggatgagccgc
aacctgtcccgccgcgagtacgtctgcctgtccgtacacccgcacaacgaccgcggtacg
gcggtggcggcggccgagctggccctgatggccggcgccgaccgcatcgagggctgtctg
ttcgggcagggcgagcgcaccggcaacgtcgacctggtcaccctgggcatgaacctgttc
tcgcagggtgtcgacccgcagatcgacttctcgaacatcgacgaggtccgccgcaccgcc
gagtactgcaaccagatggaggtccacgcccgccacccgtacgtcggcgacctcgtctac
acctccttctccggctcccaccaggacgccatcaagaagggcttcgacgcgatggaggcc
gacgcggccgccaagggcgtcacggtcgacgacatcgaatgggccgtcccgtatctgccg
atcgaccccaaggacgtcggccgctcctacgaggccgtcatccgcgtcaactcgcagtcc
ggcaagggcggcatcgcgtacgtcctgaagaacgaccacaagctggacctgccgcgccgg
atgcagatcgagttctcgaagatcatccagacgaaaacggacgccgagggcggcgaggtc
acgccgaaggacatctgggcggtcttccaggacgagtacctgccgaacccgcggaacccg
tggggccgtatccaggtcaagaccggccagaccacgacggacaaggacggcgtggacacg
ctgacggtcgaggcctcggtcgacggcgtcgacaccgtcctgaccggcagcggcaacggt
ccgatctccgcgttcttcgacgcgctgcagtccgtcggcatcgacgtacgtctgctcgac
tacaccgagcacacgatgagcgagggcgcctccgcgcaggccgcctcctacatcgaatgc
gcgatcgacgggcaggtcctgtgggggatcggcatcgacgcgaatacgacacgcgcgtcg
ctgaaggccgtcgtctccgcggtcaaccgcgccgcccgctga

DBGET integrated database retrieval system