KEGG   Streptomyces avermitilis: SAVERM_2714
Entry
SAVERM_2714       CDS       T00126                                 

Gene name
aguA
Definition
(GenBank) putative agmatine deiminase
  KO
K10536  agmatine deiminase [EC:3.5.3.12]
Organism
sma  Streptomyces avermitilis
Pathway
sma00330  Arginine and proline metabolism
sma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    SAVERM_2714 (aguA)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.12  agmatine deiminase
     SAVERM_2714 (aguA)
SSDB
Motif
Pfam: PAD_porph Lyase_8_N
Other DBs
NCBI-ProteinID: BAC70425
NITE: SAV2714
UniProt: Q82JP0
Position
complement(3329613..3330653)
AA seq 346 aa
MSTPAADGFRMPAEWTPHERTWMAWPGPNPTFDHPDDLAESCRAWADVARAIRRFEPVTV
VCGPGRSAEARDLLGPGIDTVERDLDDAWMRDIGPTFLTDGKGGLAAVDWTFNGWGAQSW
ARWEHDAKIAAYVGDLAGAKTYASKLVNEGGAIHVDGEGTVLLTETVQLGAERNPGWTRE
QVETEIHAHLGTSKAIWLPRGLTGDYPPHGFGTLGHVDIVAAFARPGVVVAHHQPDPAHP
DHEVSKEVIGLLKAATDAHGRRIEVVEVPAPTVLEADGHWADYSYINHYLCNGGVVLCGF
DDPRDETAAGIFRRLFPERTVTLVDARTIFSGGGGIHCITQQQPKN
NT seq 1041 nt   +upstreamnt  +downstreamnt
atgagcacccccgccgccgacggcttccgcatgcccgccgagtggaccccgcacgagcgc
acctggatggcgtggccgggccccaaccccaccttcgaccaccccgacgacctcgccgag
tcgtgccgggcctgggcggatgtggcccgcgcgatacgccgcttcgagccggtcaccgtc
gtgtgcgggccggggcggtcggccgaggcgcgagacctgctgggcccgggcatcgacacc
gtcgaacgcgacctcgacgacgcctggatgcgcgacatcggtcccaccttcctgaccgac
gggaagggcggactcgccgccgtcgactggacgttcaacggctggggcgcccagagctgg
gcccgctgggagcacgacgcgaagatcgccgcgtacgtcggtgacctcgccggcgcgaag
acgtacgcctcgaagctggtcaacgagggcggcgcgatccacgtcgacggcgaggggacg
gtcctgctcacggagaccgtgcagctcggtgccgagcgcaaccccggctggacccgcgag
caggtcgagacggagatccacgcccacctcgggaccagcaaggcgatctggctgccgcgc
ggactgaccggcgactacccgccgcacggcttcggcaccctcggccatgtcgacatcgtc
gccgccttcgcccgccccggcgtcgtcgtcgcgcaccaccagccggacccggcccacccc
gaccacgaggtcagcaaggaggtcatcggcctgctgaaggcggcgaccgacgcgcacggc
cggcgcatcgaggtcgtcgaggtgcccgccccgacggtcctggaggcggacggccactgg
gccgactactcctacatcaaccactacctgtgcaacggcggcgtcgtgctctgcggcttc
gacgatccgcgcgacgagaccgcggccgggatcttccgccgcctgttccccgagcggacg
gtgaccctggtggacgcccgtacgatcttctccggaggcgggggcatccactgcatcacc
cagcagcagccgaagaactga

DBGET integrated database retrieval system