KEGG   Streptomyces avermitilis: SAVERM_2715
Entry
SAVERM_2715       CDS       T00126                                 

Gene name
ureC2
Definition
(GenBank) putative urease alpha subunit
  KO
K01428  urease subunit alpha [EC:3.5.1.5]
Organism
sma  Streptomyces avermitilis
Pathway
sma00220  Arginine biosynthesis
sma00230  Purine metabolism
sma00791  Atrazine degradation
sma01100  Metabolic pathways
sma01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SAVERM_2715 (ureC2)
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    SAVERM_2715 (ureC2)
  09111 Xenobiotics biodegradation and metabolism
   00791 Atrazine degradation
    SAVERM_2715 (ureC2)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.5  urease
     SAVERM_2715 (ureC2)
SSDB
Motif
Pfam: Amidohydro_1 Urease_alpha Amidohydro_3
Other DBs
NCBI-ProteinID: BAC70426
NITE: SAV2715
UniProt: Q82JN9
Position
complement(3330663..3332333)
AA seq 556 aa
MNPYAYAATHGPRAGDRVRLGDSGLTIRVESDAQQYGDEFLAGFGKTARDGLHLKAAAVR
DTCDVVISNVVVIDAAQGIRKVSIGIREGRICSIGRAGNPDTLAGVDVVVGTGTSIVSGE
GLIATAGAVDTHVHLLSPRIMEASLASGVTTVIGQEFGPVWGVGVNSPWALRHAFSAFDA
WPVNIGFLGRGSSSDPAPLVEALAEGGASGFKVHEDMGAHTRALDTALRVAEEHDVQVAL
HSDGLNECLSVEDTLRVLDGRTIHAFHIEGCGGGHVPNVLKMAGVPNVIGSSTNPTLPFG
RDAVAEHYGMIVSVHDLKPDLPGDAAMARDRIRAGTMGAEDVLHDLGAIGITSSDAQGMG
RAGETVRRTFAMAGKMKAEFGAPEDHDNARVLRYLAKLTINPALAHGLAHEVGSIEVGKL
ADIVLWRPEFFGAKPQLVLKSGFPAYGVVGDPNAATDTCEPLVLGPQFGAHGATPAEISV
AFVAQAALDQGNDRMPTRRRRVAVRGTRGIGPADLRLNSRTGAVDVDQRTGLVTLDGDPI
RSEPADSVSLNRLYFL
NT seq 1671 nt   +upstreamnt  +downstreamnt
atgaatccctacgcatacgccgccacccacggcccccgggccggcgaccgggtccgcctc
ggcgactcggggctgacgatccgcgtcgagtccgacgcccagcagtacggggacgagttc
ctcgccgggttcggcaagaccgcccgcgacggactgcacctcaaggccgcggccgtccgc
gacacctgtgacgtcgtcatcagcaatgtcgtcgtgatcgacgcggcgcagggcatccgg
aaggtgtccatcgggatccgggaaggccggatctgctcgatcggacgggccgggaacccc
gacaccctcgccggggtcgacgtcgtggtcggcaccggcacgtccatcgtctccggagag
gggctgatcgccaccgccggagccgtcgacacccacgtccacctgctgtcgccgcgcatc
atggaggcctccctcgcctccggcgtgaccacggtcatcggccaggagttcgggcccgtg
tggggcgtcggcgtcaactcgccctgggcgctgcggcacgcgttcagcgccttcgacgcc
tggccggtcaacatcggcttcctgggccggggttcgtcgtccgacccggcgcccctggtc
gaggcactcgccgagggcggcgcgtccggcttcaaggtccacgaggacatgggcgcccac
acccgtgccctcgacaccgcgctgcgcgtcgccgaggagcacgatgtgcaggtcgccctg
cacagcgacggactgaacgagtgcctctcggtcgaggacaccctgcgggtcctcgacggg
cgcaccatccacgccttccacatcgagggctgcggcggcgggcacgtaccgaacgtgctg
aagatggcgggcgtcccgaacgtcatcggctcgtccaccaacccgaccctgcccttcggc
cgggacgcggtcgccgagcactacgggatgatcgtctccgtccacgacctcaagcccgac
ctgcccggcgacgccgccatggcccgcgaccggatccgggccgggaccatgggcgccgag
gacgtgctgcacgacctgggcgcgatcggcatcacctcgtcggacgcgcagggcatgggg
cgggcgggcgagaccgtgcgacggaccttcgcgatggccgggaagatgaaggccgagttc
ggcgcccccgaggaccacgacaacgcgcgcgtcctgcgttacctggccaagctgaccatc
aaccccgccctcgcgcacgggctcgcccacgaggtcggctcgatcgaggtcggcaagctc
gccgacatcgtgctgtggcgcccggagttcttcggcgccaagccgcagctcgtactcaag
tcgggcttccccgcgtacggggtcgtgggcgacccgaacgccgcgaccgacacctgcgaa
cccctcgtcctcgggccgcagttcggggcgcacggggcgacgcccgccgagatctcggtg
gccttcgtggcgcaggcggcgctcgaccagggcaacgaccggatgccgacccgccgacgg
agggtcgccgtgcgcggcacccgcggcatcggccccgccgacctgcgcctcaactcccgc
accggagcggtcgacgtcgaccagcgcaccggcctggtcaccctcgacggcgacccgatc
cgttccgagcccgccgactcggtctccctcaaccgcctgtacttcctctaa

KEGG   Streptomyces avermitilis: SAVERM_2716
Entry
SAVERM_2716       CDS       T00126                                 

Gene name
ureAB
Definition
(GenBank) putative urease beta/gamma subunit
  KO
K14048  urease subunit gamma/beta [EC:3.5.1.5]
Organism
sma  Streptomyces avermitilis
Pathway
sma00220  Arginine biosynthesis
sma00230  Purine metabolism
sma00791  Atrazine degradation
sma01100  Metabolic pathways
sma01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SAVERM_2716 (ureAB)
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    SAVERM_2716 (ureAB)
  09111 Xenobiotics biodegradation and metabolism
   00791 Atrazine degradation
    SAVERM_2716 (ureAB)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.5  urease
     SAVERM_2716 (ureAB)
SSDB
Motif
Pfam: Urease_gamma Urease_beta Imm75
Other DBs
NCBI-ProteinID: BAC70427
NITE: SAV2716
UniProt: Q82JN8
Position
complement(3332330..3333013)
AA seq 227 aa
MRLTPTERDRLLLFGAAELARARRARGLRLNVPEATALIADTVCEAARDGRRLAEAIAAA
RAVLGPDDVLPGVADIVTEVHVEAVFDDGSRLAVVTDPIGGGLGDQAPGALLPGPEHTEP
EAVVRVLVTNTATVPVSVTSHFHFFEANPRLDFDRAAAYGMRAAVPAGSSVRFGPGESVE
IGLVPVGGDRIAIGFAGLVDGPLDAPGAKEEALRRAAACGYLGVEQR
NT seq 684 nt   +upstreamnt  +downstreamnt
gtgcggctgacccccacggaacgtgaccggctgctgctcttcggggccgcggagctggcc
cgggcgcgcagggcgcgcggtcttcggctcaatgtgccggaggcgaccgctctcatcgcc
gacaccgtctgtgaggccgcccgggacgggcgccggctcgccgaggcgatcgccgccgcg
cgagccgtgctcggcccggacgacgtactgccgggcgtcgccgacatcgtcaccgaggtg
catgtcgaggctgtcttcgacgacggttcgcggctcgcggtggtgaccgacccgatcggg
ggagggctgggcgaccaggctccgggcgcgctgctgccggggccggaacacaccgagccc
gaggccgtcgtacgggtgctcgtcaccaacacggccaccgtgcccgtctccgtcacctcc
cacttccacttcttcgaggccaacccgcggctcgacttcgaccgcgcggccgcctacggc
atgcgggcggccgtgcccgcgggctcatcggtgcggttcgggccgggggagagcgtcgag
atcgggctcgtgcccgtcggcggcgaccggatcgcgatcgggttcgccggtctggtcgac
gggccgctggacgcgcctggggcgaaggaagaggccctgcgcagggccgccgcctgcgga
tatctcggagtcgagcagcgatga

KEGG   Streptomyces avermitilis: SAVERM_7104
Entry
SAVERM_7104       CDS       T00126                                 

Gene name
ureA
Definition
(GenBank) putative urease gamma subunit
  KO
K01430  urease subunit gamma [EC:3.5.1.5]
Organism
sma  Streptomyces avermitilis
Pathway
sma00220  Arginine biosynthesis
sma00230  Purine metabolism
sma00791  Atrazine degradation
sma01100  Metabolic pathways
sma01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SAVERM_7104 (ureA)
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    SAVERM_7104 (ureA)
  09111 Xenobiotics biodegradation and metabolism
   00791 Atrazine degradation
    SAVERM_7104 (ureA)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.5  urease
     SAVERM_7104 (ureA)
SSDB
Motif
Pfam: Urease_gamma DUF4054
Other DBs
NCBI-ProteinID: BAC74815
NITE: SAV7104
UniProt: Q826S1
Position
8464532..8464834
AA seq 100 aa
MQLTPHEQERLLIHVAADVAEKRRARGLKLNHPEAVALITSHILEGARDGRTVAELMSSG
RKLLTRDDVMEGIPEMIHDVQVEATFPDGTKLVTVHDPIV
NT seq 303 nt   +upstreamnt  +downstreamnt
gtgcaactgaccccgcacgagcaagagaggctgctgatccatgtggcagccgacgtggcc
gagaagcgccgggcccgcgggctcaagctcaaccaccccgaggcggtcgcgctcatcacg
tcgcacatcctcgaaggcgcgcgtgacggccgtacggtcgccgaactcatgtcctccggg
cgcaagctgctcacccgggacgacgtcatggagggcatccccgagatgatccacgacgtc
caggtcgaggcgaccttcccggacggcaccaagctcgtcaccgtccacgacccgatcgtc
tga

KEGG   Streptomyces avermitilis: SAVERM_7105
Entry
SAVERM_7105       CDS       T00126                                 

Gene name
ureB
Definition
(GenBank) putative urease beta subunit
  KO
K01429  urease subunit beta [EC:3.5.1.5]
Organism
sma  Streptomyces avermitilis
Pathway
sma00220  Arginine biosynthesis
sma00230  Purine metabolism
sma00791  Atrazine degradation
sma01100  Metabolic pathways
sma01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SAVERM_7105 (ureB)
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    SAVERM_7105 (ureB)
  09111 Xenobiotics biodegradation and metabolism
   00791 Atrazine degradation
    SAVERM_7105 (ureB)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.5  urease
     SAVERM_7105 (ureB)
SSDB
Motif
Pfam: Urease_beta
Other DBs
NCBI-ProteinID: BAC74816
NITE: SAV7105
UniProt: Q826S0
Position
8464852..8465163
AA seq 103 aa
MIPGEILFADGPVAYNEGREVTRLTVLNAADRPVQVGSHYHFAEANPGLDFDRAAARGKR
LNVAAGTAVRFEPGIPVDVELVPLAGARVVPGLRGETGGALDA
NT seq 312 nt   +upstreamnt  +downstreamnt
atgattcccggagagatcctcttcgccgacggacccgtcgcctacaacgagggccgcgag
gtcacccggctgaccgtcctcaacgccgccgaccggcccgtccaggtcggctcccactac
cacttcgccgaggccaaccccggtctggacttcgaccgcgccgccgcccgcggcaagcgg
ctcaacgtcgccgccggcaccgccgtgcgcttcgaacccggaatccccgtcgacgtcgaa
ctcgttccgctcgccggcgcccgcgtggtgcccgggctgcgcggggagaccggaggtgcc
ctcgatgcctga

KEGG   Streptomyces avermitilis: SAVERM_7106
Entry
SAVERM_7106       CDS       T00126                                 

Gene name
ureC1
Definition
(GenBank) putative urease alpha subunit
  KO
K01428  urease subunit alpha [EC:3.5.1.5]
Organism
sma  Streptomyces avermitilis
Pathway
sma00220  Arginine biosynthesis
sma00230  Purine metabolism
sma00791  Atrazine degradation
sma01100  Metabolic pathways
sma01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SAVERM_7106 (ureC1)
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    SAVERM_7106 (ureC1)
  09111 Xenobiotics biodegradation and metabolism
   00791 Atrazine degradation
    SAVERM_7106 (ureC1)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.5  urease
     SAVERM_7106 (ureC1)
SSDB
Motif
Pfam: Amidohydro_1 Urease_alpha Amidohydro_3 Molybdopterin_N WH2
Other DBs
NCBI-ProteinID: BAC74817
NITE: SAV7106
UniProt: Q826R9
Position
8465156..8466877
AA seq 573 aa
MPEISRPAYADLFGPTTGDRIRLADTDLLIEIEEDRSGGPGLAGDEAVFGGGKVIRESMG
QARATRADGTPDTVITGVVIVDHWGIVKADVGMRDGRITGIGKAGNPDTMDGVHPDLVIG
PETEIIAGNGRILTAGAIDAHVHLICPQIADEALGSGITTLVGGGTGPAEGSKATTVTPG
PWHLARMLEAMEEYPLNFGLLGKGNTVSHDAMLSQIRGGALGLKLHEDWGSTPAVIDAAL
TVADRTGVQIAIHTDTLNEAGFVGDTLAAIGGRGIHAYHTEGAGGGHAPDIMSVVSEPHV
LPSSTNPTRPFTVNTAEEHLDMLMVCHHLNPAVPEDLAFAESRIRPSTIGAEDILHDLGA
ISIISSDAQAMGRVGEVIMRTWQTAHVMKRRRGALPGDGRADNHRVRRYVAKYTINPALA
QGLAREIGSVETGKLADLVLWEPAFFGVKPHLVIKGGQIAYAQMGDANASIPTPQPILPR
PMFGAIGRAPASNSFNFVAPLAIEDGLPERLSLGKRFVAIESTRGVTKADMRENDARPRV
RIDPDSFAVHIDGELVEATPAAELPMAQRYFLF
NT seq 1722 nt   +upstreamnt  +downstreamnt
atgcctgagatctcgcgtcccgcctacgccgacctgttcggcccgaccaccggcgaccgc
atccggctcgccgacaccgatctgctgatcgagatcgaggaggatcgttccggcggtccc
ggactcgccggtgacgaggccgtcttcggcggcggcaaggtcatccgcgaatccatgggc
caggcgcgcgccacgcgtgcggacggcaccccggacacggtcatcaccggtgtcgtcatc
gtcgaccactggggcatcgtcaaggccgacgtcggcatgcgcgacggccggatcaccggc
atcggcaaagcgggcaacccggacaccatggacggtgtgcaccccgacctggtcatcggt
ccggagaccgagatcatcgcgggcaacggccggatcctcaccgcgggcgccatcgacgcg
catgtgcacctgatctgcccgcagatcgccgacgaggcgctcggctccgggatcaccacc
ctcgtcggcggtggcaccggccccgccgagggctccaaggccaccaccgtcacacccggc
ccctggcacctggcgcggatgctggaggcgatggaggagtacccgctcaacttcgggctc
ctcggcaagggcaacaccgtctcgcacgacgcgatgctgtcgcagatccgcggcggagca
ctcggtctcaagctgcacgaggactggggatccacgccggccgtcatcgacgccgcgctg
accgtcgccgaccggaccggcgtccagatcgccatccacacggacacgctgaacgaggcc
ggcttcgtgggcgacacgctcgccgcgatcggcggccgcggcatccacgcctaccacacc
gagggtgcgggcggcgggcacgcgccggacatcatgagcgtggtctccgagccgcacgtg
ctgcccagctccaccaacccgacccggccgttcaccgtcaacaccgccgaggaacacctc
gacatgctgatggtctgccaccacctcaacccggcggtccccgaggacctcgccttcgcc
gagtcccgcatccggccgtcgacgatcggggcggaggacatcctgcacgacctgggcgcc
atctcgatcatctcgtccgacgcccaggccatgggacgcgtgggcgaggtcatcatgcgg
acgtggcagacggcccatgtcatgaagcggcggcgcggcgcgctccccggtgacggccgc
gcggacaaccaccgcgtacgtcgctatgtcgccaagtacacgatcaacccggcactcgcg
cagggcctcgcccgcgagatcggctccgtcgagacgggcaaactcgccgacctggtgctg
tgggagcccgcgttcttcggggtcaagccgcacctcgtcatcaagggcggacagatcgcg
tacgcgcagatgggcgatgccaacgcgtccatccccacgccgcagccgattctgccccgg
ccgatgttcggggcgatcgggcgcgcgccggcctcgaactcgttcaacttcgtggcgccg
ctcgccatcgaggacgggctgccggagcggctctcgctcgggaagcggttcgtggcgatc
gagtcgacgcgcggtgtgaccaaggcggacatgcgggagaacgacgcacggccgcgggta
cggatcgaccccgacagcttcgccgtgcacatcgacggggagctggtcgaggccactccg
gccgccgaactgcccatggcccagcgctacttcctcttctga

DBGET integrated database retrieval system