KEGG   Streptomyces avermitilis: SAVERM_2717Help
Entry
SAVERM_2717       CDS       T00126                                 

Gene name
ilvE
Definition
(GenBank) putative branched-chain amino acid aminotransferase
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
sma  Streptomyces avermitilis
Pathway
sma00270  Cysteine and methionine metabolism
sma00280  Valine, leucine and isoleucine degradation
sma00290  Valine, leucine and isoleucine biosynthesis
sma00770  Pantothenate and CoA biosynthesis
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01210  2-Oxocarboxylic acid metabolism
sma01230  Biosynthesis of amino acids
Module
sma_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
sma_M00119  Pantothenate biosynthesis, valine/L-aspartate => pantothenate
sma_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SAVERM_2717 (ilvE)
   00280 Valine, leucine and isoleucine degradation
    SAVERM_2717 (ilvE)
   00290 Valine, leucine and isoleucine biosynthesis
    SAVERM_2717 (ilvE)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SAVERM_2717 (ilvE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sma01007]
    SAVERM_2717 (ilvE)
Enzymes [BR:sma01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     SAVERM_2717 (ilvE)
Amino acid related enzymes [BR:sma01007]
 Aminotransferase (transaminase)
  Class IV
   SAVERM_2717 (ilvE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_4
Motif
Other DBs
NCBI-ProteinID: BAC70428
NITE: SAV2717
UniProt: Q82JN7
Position
complement(3333251..3334339)
Genome map
AA seq 362 aa AA seqDB search
MTTPTIELKPSASPLSDAEREAILASPGFGRHFTDHMVTIKWTEGRGWHDGQLVPYAPLS
LDPATMVLHYAQEIFEGLKAYRQPDGSVASFRPDMNAKRFQASARRLGMPELPVETFIEA
CDVLVQQDASWVPAHGGEESLYLRPFMIATEVGLGVKPANEYLFLVIASPAGAYFPGGVK
PVSIWLSEDRVRAVPGGMGDAKTGGNYAASLLAQAEAAEKGCAQVAYLDAVEHKWVEELG
GMNLYFVYGNKIITPALTGSLLAGVTRDSLLSVARDLGYESEEGRVSIDQWQADTENGTL
TEVFACGTAAVITPVGTVKRSSAEWQHSGGEPGEVTLKLREALLDIQRGIGEDKHGWMHP
LG
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgcccacgatcgagctcaagccctccgccagtccgctctccgacgcggagcgc
gaggcgatcctggccagccccggattcggccgccacttcaccgaccacatggtgacgatc
aagtggacggagggacgcggctggcacgacggccagctcgttccgtacgccccgctctcc
ctcgacccggccaccatggtcctgcactacgcgcaggagatcttcgagggcctgaaggcg
taccgccagcccgacggctcggtggcctccttccgccccgacatgaacgccaagcgcttc
caggcctcggcccgccgcctcggaatgccggagctgccggtcgagacgttcatcgaggcg
tgcgacgtgctggtccagcaggacgcgtcgtgggtgccggcgcacggcggcgaggaatcc
ctctatctgcgcccgttcatgatcgcgaccgaggtcggcctgggcgtgaagcccgccaac
gagtacctcttcctcgtcatcgcgtccccggcgggcgcgtacttcccgggcggcgtgaag
ccggtctcgatctggctctccgaggaccgcgtgcgcgccgtccccggcggcatgggtgac
gccaagaccggcggcaactacgccgcgtcgctgctcgcgcaggccgaggccgccgagaag
ggctgcgcccaggtcgcgtacctcgacgcggtcgagcacaagtgggtggaggagctcggc
ggcatgaacctgtacttcgtgtacgggaacaagatcatcacgcccgccctgaccggctcc
ctcctcgcgggcgtcacccgcgactccctgctctcggtcgcccgtgacctgggctacgag
tccgaggagggccgcgtctccatcgaccagtggcaggccgacaccgagaacggcacgctg
accgaggtcttcgcctgcggtacggccgcggtcatcacgccggtcggcacggtcaagcgc
agcagcgccgagtggcagcactcgggcggtgagccgggcgaggtcaccctgaagctgcgc
gaggccctcctcgacatccagcgcggcatcggcgaggacaagcacggctggatgcacccg
ctgggctag

KEGG   Streptomyces avermitilis: SAVERM_6804Help
Entry
SAVERM_6804       CDS       T00126                                 

Definition
(GenBank) putative D-alanine aminotransferase
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
sma  Streptomyces avermitilis
Pathway
sma00270  Cysteine and methionine metabolism
sma00280  Valine, leucine and isoleucine degradation
sma00290  Valine, leucine and isoleucine biosynthesis
sma00770  Pantothenate and CoA biosynthesis
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01210  2-Oxocarboxylic acid metabolism
sma01230  Biosynthesis of amino acids
Module
sma_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
sma_M00119  Pantothenate biosynthesis, valine/L-aspartate => pantothenate
sma_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SAVERM_6804
   00280 Valine, leucine and isoleucine degradation
    SAVERM_6804
   00290 Valine, leucine and isoleucine biosynthesis
    SAVERM_6804
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SAVERM_6804
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sma01007]
    SAVERM_6804
Enzymes [BR:sma01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     SAVERM_6804
Amino acid related enzymes [BR:sma01007]
 Aminotransferase (transaminase)
  Class IV
   SAVERM_6804
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_4
Motif
Other DBs
NCBI-ProteinID: BAC74515
NITE: SAV6804
UniProt: Q827W6
Position
8124011..8124832
Genome map
AA seq 273 aa AA seqDB search
MKIWLDGGLQDSETARVSVFDHGLTVGDGIFETVKAAEGRPFALTRHLDRLARSARGLGL
PEPDLDEVRRACAAVLDANPMPLGRLRITYTGGYGPLGSDRGEKGPTLVVAVGESARRPD
STAVITVPWTRNERGALTGLKTTSYAENVVALARAREQGASEALFANTVGRLCEGTGSNV
FVVLDGEIHTPPVDSGCLAGITRALTVEWTGAKETDLPLDVLDSAEEVFLTSTLRDVQGV
HRVDSRELPGAPGPVTAKAMRLFDEQAGDDLDP
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
gtgaagatctggctcgacggcgggctgcaggactccgagaccgcccgcgtctccgtcttc
gaccacgggctgaccgtgggtgacggcatcttcgagaccgtcaaggcggccgaggggcgg
ccgttcgcgctgacccgccacctcgaccggctggcgcgttcggcgcggggcctcgggctg
cccgagcccgacctggacgaggtacgccgcgcctgcgccgccgtcctggacgccaatccg
atgccgctcggccggctgcgcatcacgtacaccggcggctacggtccgctcggctccgac
cgcggcgagaaggggccgaccctggtcgtcgccgtcggcgagtccgcccgccgccccgat
tccaccgccgtgatcaccgtgccgtggacgcgcaacgagcgcggcgcgctcaccggtctc
aagaccacctcgtacgccgagaacgtcgtcgccctcgcccgcgcgcgcgaacagggcgcg
tccgaggcgctgttcgccaacacggtcggccggctgtgcgagggcaccgggtcgaacgtc
ttcgtcgtgctcgacggcgagatccacaccccgccggtcgactccggctgcctcgcgggc
atcacccgcgcgctcaccgtcgagtggaccggcgccaaggagaccgacctgcccctcgac
gtcctggacagcgccgaggaggtgttcctcacgtccacgctgcgcgatgtgcagggcgtg
caccgggtcgactcccgcgaactcccgggcgcgccgggcccggtgaccgccaaggccatg
cggctcttcgacgagcaggccggggacgacctcgacccgtag

KEGG   Streptomyces avermitilis: SAVERM_842Help
Entry
SAVERM_842        CDS       T00126                                 

Gene name
ilvE2
Definition
(GenBank) putative branched-chain amino acid aminotransferase
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
sma  Streptomyces avermitilis
Pathway
sma00270  Cysteine and methionine metabolism
sma00280  Valine, leucine and isoleucine degradation
sma00290  Valine, leucine and isoleucine biosynthesis
sma00770  Pantothenate and CoA biosynthesis
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01210  2-Oxocarboxylic acid metabolism
sma01230  Biosynthesis of amino acids
Module
sma_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
sma_M00119  Pantothenate biosynthesis, valine/L-aspartate => pantothenate
sma_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SAVERM_842 (ilvE2)
   00280 Valine, leucine and isoleucine degradation
    SAVERM_842 (ilvE2)
   00290 Valine, leucine and isoleucine biosynthesis
    SAVERM_842 (ilvE2)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SAVERM_842 (ilvE2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sma01007]
    SAVERM_842 (ilvE2)
Enzymes [BR:sma01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     SAVERM_842 (ilvE2)
Amino acid related enzymes [BR:sma01007]
 Aminotransferase (transaminase)
  Class IV
   SAVERM_842 (ilvE2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_4
Motif
Other DBs
NCBI-ProteinID: BAC68552
NITE: SAV0842
UniProt: Q79ZQ8
Position
complement(996214..997125)
Genome map
AA seq 303 aa AA seqDB search
MDGLWQERDLPFGSNSVQHGTAVFEGIRMYTTPAGPVLFRLDAHLERLLDSAALLGIPHA
YDLAALRRHVRDAAAGSGLDNAYVRPVLYTREPRLGVNLRDFHFTLGTEIWALPPDDTPS
RPVRVTVSPWRRPSQLTFPVRAKATGTYVVSALARTRAAADGFDDAIQLDPNSGRVAEST
IANVFLVRDGRLVTPWLEDSVLAGITRDTVLTLAGDLGIETAEAPVQPGELLAADEVFLT
GTASGLVSVAGLDTHTYAAGRPVTDALSRAYREAVLGDGPHRPSWLTPVSRPTPSTSRLR
GVS
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggacggactgtggcaggagcgggacctgccgttcgggagcaacagtgtccaacatggc
acggccgtcttcgaaggcatccgcatgtacacgacgccggcaggcccggtgttgttccgg
ctcgacgcgcatctggagcggctgctggactcggcggccctgctgggcatcccgcatgcc
tacgacctggccgccctgcgccggcacgtgcgggacgcggccgccggaagcggactggac
aacgcctacgtgcggcccgtgctttacacccgagagccgcgcctcggcgtgaatctccgg
gacttccacttcactctcggcacggagatctgggcccttccccccgacgacaccccgtcc
cgacccgtacgggtcacggtgtcgccctggcgccgtccgtcacagctcacctttccggtg
cgcgccaaggcgaccggcacgtatgtggtgtccgcgctggcccgcacacgcgccgccgcg
gacggattcgacgacgccatccagttggacccgaactccggcagggtcgcggagtccacg
atcgccaacgtcttcctggttcgcgacggccgcctggtgacgccctggctcgaggacagc
gtcctggcgggcatcacccgcgacaccgtcctgaccctcgccggagacctgggcatcgag
accgccgaggcacccgtgcagcccggtgaactgctcgccgccgacgaggtgttcctgacc
gggacggcgagcggcctggtgtccgtggcgggtctcgacacccacacgtacgcggccggc
cgtcccgtgacggacgcgctgagccgcgcctatcgggaggccgtcctgggcgacggaccg
caccgtccctcctggctcacccccgtctctcgccccaccccatccacttcgcgcctccga
ggagtatcgtga

DBGET integrated database retrieval system