KEGG   Streptomyces avermitilis: SAVERM_2718Help
Entry
SAVERM_2718       CDS       T00126                                 

Gene name
leuB
Definition
(GenBank) putative 3-isopropylmalate dehydrogenase
  KO
K00052  3-isopropylmalate dehydrogenase [EC:1.1.1.85]
Organism
sma  Streptomyces avermitilis
Pathway
sma00290  Valine, leucine and isoleucine biosynthesis
sma00660  C5-Branched dibasic acid metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01210  2-Oxocarboxylic acid metabolism
sma01230  Biosynthesis of amino acids
Module
sma_M00432  Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    SAVERM_2718 (leuB)
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    SAVERM_2718 (leuB)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.85  3-isopropylmalate dehydrogenase
     SAVERM_2718 (leuB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: BAC70429
NITE: SAV2718
UniProt: Q82JN6
Position
complement(3334606..3335649)
Genome map
AA seq 347 aa AA seqDB search
MARSINLAVIPGDGIGQEVVAQGLKVLSAALPSDVKLETKEFDFGARRYHATGETLTDAD
LDALKQHDAILLGAIGDPSVPSGVLERGFLLKLRFAFDHHVNLRPSKLLPGVETPLAGQP
EIDFVVVREGTEGPYTGNGGTIRTGTPHAVATEVSLNTAFGIERVVRDAYARAQARPRKK
LALVHKNNVLVHAGHLWTDIFNKVGEEFPDVTTEYMHVDAATIYLVTQPERFDVIVTDNL
FGDIITDLAAAISGGIGVAASGNINPSGAYPSMFEPVHGSAPDIAGQGKADPSATILSVA
LLLRHLGYEAEAARIEEAVSADLAERVGKPARSTDEIGDALTVRVAG
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggctcgcagcatcaatctcgcagtgattcccggtgacggcatcggccaggaggtcgtg
gcccaggggctcaaggtcctctccgccgcccttccctcggacgtgaagctggagaccaag
gagttcgacttcggcgcccggcgctaccacgccaccggtgagaccctcaccgacgccgac
ctcgacgccctgaagcagcacgacgcgatcctgctcggcgcgatcggcgacccgtcggtc
ccgtccggcgtcctggagcgcggcttcctgctcaagctgcgcttcgccttcgaccaccac
gtcaacctgcggccctcgaagctgctccccggcgtcgagaccccgctcgccggccagccc
gagatcgacttcgtggtggtgcgcgagggcaccgaaggcccgtacaccggcaacggcggc
accatccgcaccggcaccccgcacgcggtcgccaccgaggtctcgctgaacaccgccttc
ggcatcgagcgcgtggtgcgcgacgcctatgcccgcgcccaggcccgcccccgcaagaag
ctggcgctcgtccacaagaacaacgtgctcgtgcacgccggtcacctgtggacggacatc
ttcaacaaggtgggcgaggagttcccggacgtcaccaccgagtacatgcacgtggacgcg
gcgaccatctacctcgtcacgcagcccgagcgcttcgacgtgatcgtcaccgacaacctc
ttcggtgacatcatcaccgacctcgccgcggcgatctccggcggcatcggagtcgccgcc
tccggcaacatcaacccgtccggcgcgtacccgtcgatgttcgagcccgtgcacggctcg
gcacccgacatcgccggccagggcaaggcggacccgtccgccacgatcctgtccgtcgcc
ctcctgctgcgccacctcggctacgaggccgaggccgcgcgtatcgaggaggccgtctcc
gccgacctcgcggagcgtgtgggcaagcccgcccgcagcaccgacgagatcggtgacgcg
ctcaccgtacgagtagcaggctga

DBGET integrated database retrieval system