KEGG   Streptomyces avermitilis: SAVERM_2723
Entry
SAVERM_2723       CDS       T00126                                 

Gene name
rocA
Definition
(GenBank) putative delta-1-pyrroline-5-carboxylate dehydrogenase
  KO
K00294  1-pyrroline-5-carboxylate dehydrogenase [EC:1.2.1.88]
Organism
sma  Streptomyces avermitilis
Pathway
sma00250  Alanine, aspartate and glutamate metabolism
sma00330  Arginine and proline metabolism
sma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SAVERM_2723 (rocA)
   00330 Arginine and proline metabolism
    SAVERM_2723 (rocA)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     SAVERM_2723 (rocA)
SSDB
Motif
Pfam: Aldedh P53_TAD
Other DBs
NCBI-ProteinID: BAC70434
NITE: SAV2723
UniProt: Q82JN1
Position
complement(3339557..3341188)
AA seq 543 aa
MDAVTQVPTPVNEPVHGYAPGSPERARLEAKLKELAENPIELPMTIGGEKRLGGGERFEV
VQPHNHKAVIGTGAHATQQDAQDAIDAALAAAPAWRAMSFDDRAAIILRAAELLSGPWRE
TLAASTMLGQSKTAQQAEIDCPCELVDFWRFNVKYARDLLAEQPPANSPGVWNRLDHRPL
EGFVYAITPFNFSAIAGNLPTAPALMGNVVVWKPSPTQTHAAVLLMRLLEEAGLPKGVIN
LVTGDGIEVSKVALEHRDLAGIHFTGSTKTFQYLWKTVGNNIEKYRSYPRLVGETGGKDF
LVAHPSADRAVLKTALTRGAFEYQGQKCSATSRAYLPASIWNSGFKEEFAAEVDYLTMGD
VTDLSNFVGAVIDERSFAKNKAAIDRAKSDPTCTIVAGGEYDDSVGYFVRPTVVECSDPE
NEVFKTEYFGPFLAVHVYEDDAYDEMLTQMESASDYALTGAVVSNDRAAAAYTMDKLRYA
AGNFYINDKSTGAVVGQQPFGGGRASGTNDKAGAPQNLMRWTLTRAIKETLVPPTDYTYP
HMG
NT seq 1632 nt   +upstreamnt  +downstreamnt
atggatgctgtgacccaggtccccacccccgtcaatgagccggtgcacggctatgccccc
ggctcgcccgagcgcgcccgtctggaggccaagctcaaggagctggccgagaacccgatc
gagctgccgatgaccatcggcggcgagaagcggctcggcggcggtgagcgcttcgaggtg
gtgcagccgcacaaccacaaggccgtcatcggcaccggcgcgcacgccacgcagcaggac
gcgcaggacgcgatcgacgccgcgctggccgccgccccggcctggcgcgcgatgtccttc
gacgaccgcgccgcgatcatcctgcgcgccgccgagctgctgtccggcccgtggcgcgag
accctcgccgcctccaccatgctcggccagtcgaagaccgcccagcaggccgagatcgac
tgtccgtgcgaactggtcgacttctggcgcttcaacgtcaagtacgcccgcgacctgctc
gccgagcagcccccggccaactcgccgggcgtctggaaccgcctcgaccaccgcccgctc
gagggcttcgtctacgcgatcaccccgttcaacttctcggcgatcgcgggcaacctgccg
acggctccggcgctcatgggcaacgtggtcgtgtggaagccgtccccgacgcagacccac
gccgccgtgctgctgatgcggctcctggaggaggcgggcctgcccaagggcgtcatcaac
ctcgtcaccggtgacggcatcgaggtctccaaggtcgccctggagcaccgcgatctcgcg
ggcatccacttcacgggttcgaccaagaccttccagtacctgtggaagacggtcggcaac
aacatcgagaagtaccgctcgtacccgcgcctggtcggcgagaccggcggcaaggacttc
ctggtcgcgcacccgagcgccgaccgcgcggtcctgaagaccgccctgacccgcggtgcc
ttcgagtaccagggccagaagtgctccgcgacctcccgcgcctaccttccggcctccatc
tggaactccggcttcaaggaggagttcgcggccgaggtcgactacctgaccatgggtgac
gtcaccgacctgtcgaacttcgtcggcgcggtcatcgacgagcgctcgttcgccaagaac
aaggcggccatcgaccgcgccaagtcggacccgacctgcacgatcgtggcgggcggcgag
tacgacgactcggtcggctacttcgtgcgcccgacggtcgtcgagtgctcggacccggag
aacgaggtcttcaagaccgagtacttcggcccgttcctcgccgtgcacgtctacgaggac
gacgcgtacgacgagatgctgacccagatggagtcggcctcggactacgcgctgacgggt
gcggtcgtctccaacgaccgtgcggcggccgcgtacacgatggacaagctccgctacgcc
gcgggcaacttctacatcaacgacaagtcgaccggcgccgtcgtcggccagcagcccttc
ggcggcggccgtgcctcgggcacgaacgacaaggcgggcgccccgcagaacctgatgcgc
tggacgctgacccgcgccatcaaggagacgctggtcccgccgaccgactacacgtacccg
cacatgggctga

DBGET integrated database retrieval system