KEGG   Streptomyces avermitilis: SAVERM_2731
Entry
SAVERM_2731       CDS       T00126                                 

Gene name
ilvC
Definition
(GenBank) ketol-acid reductoisomerase
  KO
K00053  ketol-acid reductoisomerase [EC:1.1.1.86]
Organism
sma  Streptomyces avermitilis
Pathway
sma00290  Valine, leucine and isoleucine biosynthesis
sma00770  Pantothenate and CoA biosynthesis
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01210  2-Oxocarboxylic acid metabolism
sma01230  Biosynthesis of amino acids
Module
sma_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
sma_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    SAVERM_2731 (ilvC)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SAVERM_2731 (ilvC)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.86  ketol-acid reductoisomerase (NADP+)
     SAVERM_2731 (ilvC)
SSDB
Motif
Pfam: IlvN IlvC F420_oxidored 2-Hacid_dh_C NAD_binding_2 AdoHcyase_NAD CoA_binding PDH ApbA Rossmann-like NAD_binding_7
Other DBs
NCBI-ProteinID: BAC70442
NITE: SAV2731
UniProt: Q59818
Position
complement(3352764..3353765)
AA seq 333 aa
MAELFYDADADLSIIQGRKVAVIGYGSQGHAHALSLRDSGVDVRVGLHEGSKSKAKAEEQ
GLRVVTPSEAAAEADVIMILVPDPIQAQVYEESIKDNLKDGDALFFGHGLNIRFGFIKPP
AGVDVCMVAPKGPGHLVRRQYEEGRGVPCIAAVEQDATGNGFALALSYAKGIGGTRAGVI
KTTFTEETETDLFGEQAVLCGGTAALVKAGFETLTEAGYQPEIAYFECLHELKLIVDLMY
EGGLEKMRWSISETAEWGDYVTGPRIITDATKAEMKKVLAEIQDGTFAQAWMDEYHGGLK
KYNEYKTQDENHLLETTGKELRKLMSWVNDEEA
NT seq 1002 nt   +upstreamnt  +downstreamnt
gtggccgagctgttctacgacgccgacgccgacctgtccatcatccagggccgcaaggtc
gcggtcatcggctacggcagccagggccacgcccacgcgctgtcgctgcgtgactcgggt
gtcgacgtccgcgtcggtctgcacgagggctccaagtccaaggcgaaggccgaggagcag
ggcctgcgcgtggtgacgccgtcggaggccgccgccgaggccgacgtcatcatgatcctc
gtcccggacccgatccaggcccaggtctacgaggagtccatcaaggacaacctcaaggac
ggcgacgcgctgttcttcggccacggcctgaacatccgcttcggcttcatcaagcccccg
gccggcgtcgacgtgtgcatggtcgcccccaagggcccgggccacctggtccgccgccag
tacgaggagggccgcggcgttccgtgcatcgcggccgtcgagcaggacgcgacgggcaac
ggcttcgcgctcgccctctcgtacgcgaagggcatcggcggcacccgcgccggcgtcatc
aagacgaccttcaccgaggagaccgagaccgacctgttcggtgagcaggcggttctctgc
ggtggtacggccgcgctggtcaaggccggcttcgagacgctgaccgaggcgggctaccag
ccggagatcgcgtacttcgagtgcctccacgagctgaagctgatcgtcgacctcatgtac
gagggcggcctggagaagatgcgctggtcgatctccgagaccgccgagtggggcgactac
gtcaccggcccccgcatcatcacggacgccaccaaggccgagatgaagaaggtcctcgcc
gagatccaggacggcacgttcgcccaggcctggatggacgagtaccacggcggtctgaag
aagtacaacgagtacaagacccaggacgagaaccacctcctggagaccaccggcaaggag
ctgcgcaagctcatgagctgggtgaacgacgaagaggcgtaa

DBGET integrated database retrieval system