KEGG   Streptomyces avermitilis: SAVERM_2748Help
Entry
SAVERM_2748       CDS       T00126                                 

Gene name
ligA
Definition
(GenBank) putative DNA ligase
  KO
K01972  DNA ligase (NAD+) [EC:6.5.1.2]
Organism
sma  Streptomyces avermitilis
Pathway
sma03030  DNA replication
sma03410  Base excision repair
sma03420  Nucleotide excision repair
sma03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SAVERM_2748 (ligA)
   03410 Base excision repair
    SAVERM_2748 (ligA)
   03420 Nucleotide excision repair
    SAVERM_2748 (ligA)
   03430 Mismatch repair
    SAVERM_2748 (ligA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sma03032]
    SAVERM_2748 (ligA)
   03400 DNA repair and recombination proteins [BR:sma03400]
    SAVERM_2748 (ligA)
Enzymes [BR:sma01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.2  DNA ligase (NAD+)
     SAVERM_2748 (ligA)
DNA replication proteins [BR:sma03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     SAVERM_2748 (ligA)
DNA repair and recombination proteins [BR:sma03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA ligase
     SAVERM_2748 (ligA)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     SAVERM_2748 (ligA)
   MMR (mismatch excision repair)
    DNA ligase
     SAVERM_2748 (ligA)
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      SAVERM_2748 (ligA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_aden DNA_ligase_OB HHH_2 BRCT DNA_ligase_ZBD PTCB-BRCT HHH_5 HHH Auto_anti-p27 HHH_8
Motif
Other DBs
NCBI-ProteinID: BAC70459
NITE: SAV2748
UniProt: Q82JK7
Position
complement(3375523..3377715)
Genome map
AA seq 730 aa AA seqDB search
MAGEQHAQPTSVPAEAREKHAQLAEQIEEHRFRYYVKDAPVVSDAEFDTLLRSLEALEEE
YPELRTPDSPTQKVAGGYETEFTAVQHRERMLSLDNAFDDLGLAAWAERVAKDVGTSDYH
FLCELKVDGLAVNLTYEHGRLTRAATRGDGRTGEDITPNVRTIAEIPDRLKGDRIPDLVE
IRGEVYFPMEKFEELNARLVEAGDKPFANPRNAAAGSLRQKDPRVTATRPLHMVVHGIGA
RQGFDIDRLSQAYELLREWGLPTTRYARVVDDLDGVREFIAYYGENRHSVEHEIDGVVVK
LDEIPLQGRLGSTSRAPRWAIAWKYAPEEVNTKLINIRVGVGRTGRVTPYAQVEPVTVAG
SEVEFATLHNQDVVKAKGVLIGDTVVLRKAGDVIPEILGPVVDLRDGTERAFVMPAECPE
CGTPLAPAKEGDVDLRCPNARTCPAQLRERLFYLAGRKSLDIEQFGYVAAAALTKPLEPA
EPPLLDEGDLFDLTIERLLPIKAYVLDQDSGLPKRDPKTGEEKVATVFANQQGEPRKNAI
SMLDNIAAAKERPLARILTGLSIRHVGPVAAEALARAFRSIDRIDQATEEELKDTDGVGP
IVAAAVKQWFAEDWHREIIRKWKAAGVRMEDERSGEDEGPRPLEGLTVVVTGTLEHHTRD
GAKEALQSRGAKVTGSVSKKTSFVVVGDNPGSKYDKAMQLKVPVLNEAGFAVLLEQGPEA
AAEVALPTEE
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
gtggccggcgaacagcacgcacagcccacatcggtacccgccgaggcacgggagaagcac
gcgcagctcgctgagcagatcgaggagcaccgcttccggtactacgtgaaggacgccccc
gtcgtcagcgacgcggagttcgacaccctcctgcgctccctcgaggcactggaggaggag
taccccgagctgcgcacgcccgactcaccgacccagaaggtcgcgggcgggtacgagacg
gagttcacggccgtccagcaccgtgagcgcatgctctccctggacaacgccttcgacgac
ctggggctggccgcctgggccgagcgcgtcgccaaggacgtcggcacctccgactaccac
ttcctgtgcgagctgaaggtcgacggcctcgccgtcaacctcacgtatgagcacggccgc
ctcacgcgcgcggcgacccgcggcgacggccgcacgggcgaggacatcacgcccaacgtc
cgtacgatcgcggagattccggaccgtctcaagggcgaccgcatcccggacctcgtggag
atccgcggcgaggtctacttcccgatggagaagttcgaggagctcaacgcacgtctggtg
gaggccggcgacaagcccttcgccaacccgcgcaacgcggcggcgggttcactgcgccag
aaggacccgcgggtcaccgcgacccgcccgctgcacatggtcgtccacggcatcggcgcc
cggcagggcttcgacatcgaccggctctcccaggcgtacgagctgctgcgcgagtggggc
ctgccgaccacccggtacgccagagtggtcgacgacctcgacggcgtacgggagttcatc
gcgtactacggggagaaccgccactccgtggagcacgagatcgacggcgtggtcgtgaag
ctcgacgagatcccgctccagggccgcctcggctccacctcccgcgcgccgcgctgggcg
atcgcctggaagtacgcgcccgaggaggtcaacaccaagctcatcaacatccgcgtgggc
gtggggcgtacgggccgggtcacgccgtacgcgcaggtggagccggtcacggtcgcgggc
tcggaggtcgagttcgccaccctgcacaaccaggacgtcgtcaaggccaagggcgtcctc
atcggggacacggtggtgctgcgcaaggccggtgacgtcatcccggagatcctcggcccg
gtcgtcgacctgcgcgacggcaccgagcgcgcgttcgtgatgcccgccgagtgccccgag
tgcggtacgccgctggcgccggccaaggagggcgacgtcgacctgcgctgcccgaacgcg
cgcacgtgtccggcccagctgcgggagcggctcttctatctcgcgggccgcaagtcgctc
gacatcgagcagttcggatatgtcgcggcggcggccctcaccaagccgctggagcccgcc
gagccgccgctgctcgacgagggcgacctcttcgacctcaccatcgaacggctgctgccc
atcaaggcgtacgtcctcgaccaggacagcggcctgcccaagcgggacccgaagacgggc
gaggagaaggtcgccacggtcttcgccaaccagcagggcgagccgcggaagaacgcgatc
tcgatgctggacaacatcgcggccgccaaggagcgcccgctcgcccggatcctgaccggt
ctgtcgatccgccacgtcgggccggtcgcggccgaggcgctggcgcgcgcgttccgctcg
atcgaccgcatcgaccaggccaccgaggaggagctgaaggacaccgacggtgtcggcccg
atcgtcgccgccgcggtcaagcagtggttcgccgaggactggcaccgggagatcatccga
aagtggaaggccgccggcgtccgcatggaggacgagcgctccggagaggacgaggggccg
cgcccgctcgaaggactcacggtcgtcgtcaccggaacgctcgaacaccacacgcgggac
ggcgcgaaggaggccctgcagagccgcggggcgaaagtcaccggttcggtttcgaagaag
acgtctttcgttgtcgtaggtgacaatcctggatcgaaatacgacaaggcgatgcagctg
aaggttcccgttctgaacgaggccggattcgccgttctgctcgagcaaggaccggaagcc
gctgcggaagtcgcacttccgaccgaggagtag

KEGG   Streptomyces avermitilis: SAVERM_7136Help
Entry
SAVERM_7136       CDS       T00126                                 

Gene name
ligB
Definition
(GenBank) putative DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
sma  Streptomyces avermitilis
Pathway
sma03030  DNA replication
sma03410  Base excision repair
sma03420  Nucleotide excision repair
sma03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SAVERM_7136 (ligB)
   03410 Base excision repair
    SAVERM_7136 (ligB)
   03420 Nucleotide excision repair
    SAVERM_7136 (ligB)
   03430 Mismatch repair
    SAVERM_7136 (ligB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sma03032]
    SAVERM_7136 (ligB)
   03400 DNA repair and recombination proteins [BR:sma03400]
    SAVERM_7136 (ligB)
Enzymes [BR:sma01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     SAVERM_7136 (ligB)
    6.5.1.6  DNA ligase (ATP or NAD+)
     SAVERM_7136 (ligB)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     SAVERM_7136 (ligB)
DNA replication proteins [BR:sma03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   Other elongation factors
    SAVERM_7136 (ligB)
 Prokaryotic type
   Elongation factors (archaeal)
    Other elongation factors
     SAVERM_7136 (ligB)
DNA repair and recombination proteins [BR:sma03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     SAVERM_7136 (ligB)
   NER (nucleotide excision repair)
    Other NER factors
     SAVERM_7136 (ligB)
   MMR (mismatch excision repair)
    Other MMR factors
     SAVERM_7136 (ligB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C DNA_ligase_A_N RNA_ligase
Motif
Other DBs
NCBI-ProteinID: BAC74847
NITE: SAV7136
UniProt: Q826P6
Position
complement(8495569..8497107)
Genome map
AA seq 512 aa AA seqDB search
MLLSRLAHVSREVAATSARSRKIALLAELFRDADADDVPIVIPYLAGRLPQGRLGIGWKL
LGRPVTPASEPSLTVRDVDARLTAVGAVTGTGSQAGRGRLMGELMAAATDVEQAFLRGLL
TGEVRQGALDAVAVEGLAEATGAPPADVRRAVMLAGSLQTVARALLAEGPGALDGFRLTV
GRPVLPMLAHTAGSVAEAVGKLGACAVEEKLDGIRVQLHRDGDHVRIYTRTLDDITDRLP
ELTAAALELKGDRFILDGEVIALDGNGRPRSFQEIAGRVGSRVDVAAAAASVPVSPVFFD
ALSVDGRDLLDLPFTERHAELARLVPEPLRVRRALVSGPDDGAAAETFLADTLARGHEGV
VVKALDAPYSAGRRGASWLKVKPVHTLDLVVLAAEWGHGRRTGKLSNLHLGARAADGSFA
MLGKTFKGMTDAMLTWQTERLTELAVEENGSVVTVRPELVVEIAYDGLQKSTRYPAGVTL
RFARVVRYREDKTPAEADTVETLLAAHPEVTR
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgagccgcctcgcccatgtgtcccgggaggtcgccgccacctcggcgcggtcc
cggaagatcgcgctgctcgccgagctgttccgggacgccgacgcggacgacgtgccgatc
gtgatcccgtatctggccggacgccttccgcaggggcggctcggcatcggctggaagctc
ctcggccggccggtcacgcccgcgtcggagccgtcgctcaccgtgcgggacgtggacgcc
cggctgacagcggtcggcgccgtcacgggcaccggctcgcaggccgggcgcgggcgcctg
atgggcgagctgatggcggcggccaccgacgtcgagcaggccttcctgcgcgggctgctc
accggcgaggtgcggcagggcgcgctggacgcggtcgcggtcgaggggctggccgaggcg
accggcgcgccccccgccgacgtacgacgggcggtgatgctcgccggatcgctccagacg
gtggcgcgggcgctgctcgcggagggcccgggggccctggacggcttccggctcaccgtc
ggccgcccggtgctgccgatgctggcgcacacggcgggatccgtggccgaggccgtcggc
aagctgggcgcgtgtgccgtcgaggagaagctcgacggcatccgcgtccagctccaccgc
gacggcgaccacgtacggatctacacccgcaccctcgacgacatcaccgaccggttgccc
gaactcaccgccgccgccctggagttgaagggcgaccggttcattctggacggtgaggtc
atcgcgctggacgggaacgggcggccgcgctccttccaggagatcgccgggcgcgtgggc
tcgcgcgtggacgtggccgcggccgccgcgtcggtgcccgtctcccccgtgttcttcgac
gcgctgtccgtcgacggacgggatctgctcgacctgccgttcaccgagcggcacgcggag
ctggcccggctggtgcccgagccgctgcgcgtgcggcgcgcgctcgtgtccggtcccgac
gatggcgccgccgccgagacgttcctcgccgacacgctcgcgcgcggccacgagggcgtc
gtggtcaaagccctcgacgccccctacagcgcgggccggcgcggcgcctcctggctgaag
gtcaagcccgtgcacaccctcgacctggtggtgctcgcggccgagtggggccacgggcgg
cgcaccggcaagctgtccaacctgcacctcggggcgcgcgccgcggacgggtccttcgcg
atgctcggcaagacgttcaagggcatgaccgacgcgatgctgacctggcagaccgagcgg
ctgacggagctggccgtcgaggagaacggctccgtggtgaccgtacggccggaactcgtc
gtcgagatcgcgtacgacggtctccagaagtccacccgctacccggccggcgtcaccctc
cgcttcgcccgcgtcgtccggtaccgcgaggacaagaccccggccgaggccgacacggtc
gagaccttgctcgccgcgcacccggaggtgacccggtga

DBGET integrated database retrieval system