KEGG   Streptomyces avermitilis: SAVERM_2775Help
Entry
SAVERM_2775       CDS       T00126                                 

Gene name
glyA1
Definition
(GenBank) putative serine hydroxymethyltransferase
  KO
K00600  glycine hydroxymethyltransferase [EC:2.1.2.1]
Organism
sma  Streptomyces avermitilis
Pathway
sma00260  Glycine, serine and threonine metabolism
sma00460  Cyanoamino acid metabolism
sma00630  Glyoxylate and dicarboxylate metabolism
sma00670  One carbon pool by folate
sma00680  Methane metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
sma01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SAVERM_2775 (glyA1)
  09102 Energy metabolism
   00680 Methane metabolism
    SAVERM_2775 (glyA1)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAVERM_2775 (glyA1)
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    SAVERM_2775 (glyA1)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SAVERM_2775 (glyA1)
Enzymes [BR:sma01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.1  glycine hydroxymethyltransferase
     SAVERM_2775 (glyA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SHMT Aminotran_1_2 Beta_elim_lyase Cys_Met_Meta_PP Aminotran_5 DegT_DnrJ_EryC1 Met_gamma_lyase
Motif
Other DBs
NCBI-ProteinID: BAC70486
NITE: SAV2775
UniProt: Q82JI0
Position
3403925..3405187
Genome map
AA seq 420 aa AA seqDB search
MSLLNTPLHELDPDVAAAVDAELNRQQSTLEMIASENFAPVAVMEAQGSVLTNKYAEGYP
GRRYYGGCEHVDVVEQIAIDRVKELFGAEHANVQPHSGAQANAAAMFALLKPGDTIMGLN
LAHGGHLTHGMKINFSGKLYNVVAYHVDETTGQVDMAEVEKLAKESRPKLIVAGWSAYPR
QLDFAAFRRIADEVGAYLMVDMAHFAGLVAAGLHPNPVPHAHVVTTTTHKTLGGPRGGVI
LSTAELAKKINSAVFPGQQGGPLEHVIAAKAVSFKVAASDDFKERQQRTLDGARILAERL
VRDDVKAVGVDVLSGGTDVHLVLVDLRDSELDGQQAEDRLHEVGITVNRNAIPNDPRPPM
VTSGLRIGTPALATRGFQAADFTEVADIIAEALKPSYDADALKARVTALADKHPLYPGLK
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcttctgaacacgcctctgcacgagctcgacccggacgtcgccgccgccgtcgac
gccgagctgaaccgtcagcagtccaccctcgagatgatcgcctcggagaacttcgctccg
gtcgcggtcatggaggcccagggctcggtcctcaccaacaagtacgccgagggctacccg
ggccgccgctactacggcggctgcgagcacgtcgatgtggtcgagcagatcgccatcgac
cgggtcaaggagctgttcggcgccgagcacgccaacgtccagccgcactcgggcgcccag
gccaacgcggccgccatgttcgcgctgctcaagcccggcgacacgatcatgggtctgaac
ctcgcgcacggcgggcacctgacccacggcatgaagatcaacttctccggcaagctgtac
aacgtggtcgcgtaccacgtggacgagaccaccggccaggtggacatggccgaggtcgag
aagctggccaaggagtccaggccgaagctgatcgtggccggctggtcggcgtacccgcgc
cagttggacttcgccgcgttccgccggatcgcggacgaggtcggcgcgtacctgatggtc
gacatggcgcacttcgccggcctggtggcggcgggtctgcacccgaaccccgtgccgcac
gcccatgtcgtgaccacgaccacgcacaagacgctgggcggcccgcgcggtggcgtgatc
ctgtcgacggccgaactggccaagaagatcaactccgcggtcttcccgggtcagcagggt
ggtccgctggagcacgtgatcgccgccaaggccgtctccttcaaggtcgccgcctccgac
gacttcaaggagcgccagcagcgcacgctggacggcgcccgcatcctggccgagcgtctg
gtccgggacgacgtcaaggccgtgggcgtggacgtcctctcgggcggcacggacgtgcac
ctggtcctcgtcgacctgcgcgactccgagctggacggccagcaggccgaggaccgcctc
cacgaggtcggcatcacggtcaaccgcaacgccatcccgaacgacccgcgcccgccgatg
gtgacgtccggcctgcgcatcggtacgccggccctcgccacccgcggcttccaggccgcg
gacttcaccgaggtcgcggacatcatcgccgaggcgctgaagccgtcctacgacgcggac
gccctcaaggcccgggtgacggcactggcggacaagcacccgctgtatcccggtctgaag
tag

KEGG   Streptomyces avermitilis: SAVERM_2908Help
Entry
SAVERM_2908       CDS       T00126                                 

Gene name
glyA2
Definition
(GenBank) putative serine hydroxymethyltransferase
  KO
K00600  glycine hydroxymethyltransferase [EC:2.1.2.1]
Organism
sma  Streptomyces avermitilis
Pathway
sma00260  Glycine, serine and threonine metabolism
sma00460  Cyanoamino acid metabolism
sma00630  Glyoxylate and dicarboxylate metabolism
sma00670  One carbon pool by folate
sma00680  Methane metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
sma01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SAVERM_2908 (glyA2)
  09102 Energy metabolism
   00680 Methane metabolism
    SAVERM_2908 (glyA2)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAVERM_2908 (glyA2)
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    SAVERM_2908 (glyA2)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SAVERM_2908 (glyA2)
Enzymes [BR:sma01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.1  glycine hydroxymethyltransferase
     SAVERM_2908 (glyA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SHMT DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: BAC70619
NITE: SAV2908
UniProt: Q82J74
Position
complement(3639464..3640735)
Genome map
AA seq 423 aa AA seqDB search
MSVTHVPEAVRPAVAGADFEALRRQDPELAEILIGELDRQSTTLQLIAAENFTSPAVLAA
LGSPLANKYAEGYPGARYHGGCEFVDVAERLAVDRATALFGAAHANVQSHSGSSAVLAAY
AALLRPGDTVLAMGLPFGGHLTHGSPANFSGRWFDFVGYGVDAETGLIDYEQVRTLARSH
RPKAIVCGSISYPRHIDYAAFREIADEVGAHLIADAAHPIGLVAGGAAPNPVPYADVVCA
TTHKVLRGPRGGMILCGGELAERIDRAVFPFTQGGAQMHTIAAKAVAFGEAATPAFAAYA
RQVVANARVLAERLAAEGLAITTGGTDTHLLTVDPAPLGVEGRTARGRLAAAGMVLDTCA
LPHGDARGLRLGTAALTTQGMGETEMARVAKLFAGVLRDETDSKTAREEVRELAGGFPPY
PGR
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtcacgcatgtaccggaagccgtacggcccgccgtcgccggggccgacttcgag
gcccttcgtcggcaggatcccgagctggccgagatcctcatcggggagctcgaccggcag
tcgaccacgttgcagctgatcgccgccgagaacttcacctcgccggccgtgctcgccgcc
ctcggctcaccgctcgccaacaagtacgccgaggggtaccccggtgcccggtaccacggc
ggctgcgagttcgtcgatgtcgccgagcgcctggccgtcgaccgggcgacggccctgttc
ggcgccgcgcacgccaatgtgcagtcgcactccggctcgtccgcggtgctcgccgcgtac
gccgcgctgctgcggcccggggacaccgtcctcgcgatgggcctgccgttcggcggccat
ctcacgcacggctcgcccgccaacttctccggccgctggttcgacttcgtcggctacggg
gtggacgccgagaccgggctcatcgactacgagcaggtgcgcaccctcgcacggtcgcac
cgcccgaaggccatcgtctgcggatccatctcctatccccggcacatcgactacgcggcg
ttccgcgagatcgccgatgaggtgggcgcccatctcatcgccgacgccgcccaccccatc
gggctcgtcgccgggggagcggcgcccaatccggtgccgtacgccgatgtcgtctgcgcc
accacccacaaggtgctgcgcggcccccgcggcggcatgatcctctgcggcggtgaactg
gccgagcgcatcgaccgggccgtcttcccgttcacgcagggcggcgcgcagatgcacacc
atcgccgccaaggccgtcgcgttcggcgaggcggcgaccccggctttcgccgcgtacgcc
cgtcaggtggtcgccaacgcgcgcgtgctcgccgagaggctggccgccgaggggctcgcg
atcaccaccggcggcacggacacccacctgctgaccgtcgatcccgcgccgctcggcgtg
gagggccgcaccgcccgcggccggttggccgccgcgggcatggtcctcgacacctgtgcc
cttcctcacggcgacgcccgcggtctgcgcctcggcacggccgcgctgaccacccagggg
atgggcgagaccgagatggcccgcgtcgccaagctgttcgcgggcgtgctgcgggacgag
accgacagcaagacggcacgtgaagaagtgcgggagctggctggtggatttccgccgtat
cccggccggtga

KEGG   Streptomyces avermitilis: SAVERM_3419Help
Entry
SAVERM_3419       CDS       T00126                                 

Gene name
glyA3
Definition
(GenBank) putative serine hydroxymethyltransferase
  KO
K00600  glycine hydroxymethyltransferase [EC:2.1.2.1]
Organism
sma  Streptomyces avermitilis
Pathway
sma00260  Glycine, serine and threonine metabolism
sma00460  Cyanoamino acid metabolism
sma00630  Glyoxylate and dicarboxylate metabolism
sma00670  One carbon pool by folate
sma00680  Methane metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
sma01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SAVERM_3419 (glyA3)
  09102 Energy metabolism
   00680 Methane metabolism
    SAVERM_3419 (glyA3)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAVERM_3419 (glyA3)
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    SAVERM_3419 (glyA3)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SAVERM_3419 (glyA3)
Enzymes [BR:sma01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.1  glycine hydroxymethyltransferase
     SAVERM_3419 (glyA3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SHMT Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: BAC71131
NITE: SAV3419
UniProt: Q82HT9
Position
complement(4240427..4241875)
Genome map
AA seq 482 aa AA seqDB search
MPEQPLSTESTAFRSALDVIRAVEPRVADAIGQEIADQREMLKLIASENYASPATLLAMG
NWFSDKYAEGTVGRRFYAGCRNVDTVEALAAEHARELFGAQHAYAQPHSGIDANLVAFWA
VLADRVEAPALAKAGVRNVNDLSDADWAELRRAFGNQRMLGMSLDAGGHLTHGFRPNISG
KMFDQRSYGTDPATGLIDYEALRTSAREFKPLIIVAGYSAYPRLVNFRIMREIADEVGAT
LMVDMAHFAGLVAGKVLTGDFDPVPHAQIVTTTTHKSLRGPRGGMVLCDDSLKDQVDRGC
PMVLGGPLPHVMAAKAVALAEARRPEFRDYAQAVVDNSRALAEGLVRRGATLVTGGTDNH
LNLIDVASSYGLTGRQAETALLDSGIVTNRNAIPADPNGAWYTSGIRIGTPALTTRGLGT
AEMDEIAGLIDRVLTTTEPGTTAKGAPSKAQHVLDPKIADEIAHRAGDLLTGFPLYPEID
LG
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagcagcccctttccaccgagtccaccgccttccgcagcgccctcgacgtgatc
cgggccgtggagccccgcgtcgccgacgccatcgggcaggagatcgccgaccagcgcgag
atgctcaagctgatcgcctccgagaactacgcctctccggccaccctcctggccatgggc
aactggttcagcgacaagtacgccgagggcacggtcggccgccgcttctacgccggctgc
cgcaacgtcgacaccgtcgaggcactcgccgccgagcacgcccgcgagctcttcggcgcc
cagcacgcctacgcccagccgcactccggcatcgacgccaacctcgtcgccttctgggcc
gtcctcgcggaccgggtggaggcccccgccctcgcgaaggcgggcgtccgcaacgtcaac
gacctctccgacgccgactgggccgagctgcgccgcgccttcggcaaccagcgcatgctc
ggcatgtccctggacgccggcggccacctcacccacggcttccgcccgaacatctccggc
aagatgttcgaccagcgctcctacggcaccgaccccgccaccggcctcatcgactacgag
gccctgcgcacctccgcccgcgagttcaagccgctgatcatcgtcgccggctactccgcc
tacccccgcctcgtgaacttccggatcatgcgggagatcgccgacgaggtcggcgcgacc
ctgatggtcgacatggcgcacttcgccggcctcgtcgcgggcaaggtcctcaccggcgac
ttcgacccggtcccgcacgcccagatcgtgacgaccaccacgcacaagtcgctgcgcggc
ccgcgcggcggcatggtgctgtgcgacgactcgctcaaggaccaggtcgaccgcggctgc
ccgatggtcctcggtggcccccttccgcacgtcatggccgccaaggccgtcgcgctcgcc
gaggcccgccgccccgagttccgcgactacgcccaggccgtcgtcgacaactcccgcgcc
ctcgccgagggcctggtgcgccgcggcgccaccctggtcaccggcggcaccgacaaccac
ctcaacctgatcgacgtcgcctcctcctacggcctcaccggccgccaggccgagaccgcg
ctgctcgactcgggcatcgtcaccaaccgcaacgcgatccccgccgaccccaacggcgcc
tggtacacctccggcatccgcatcggcacgcccgccctgaccacgcgcggcctcggcacg
gccgagatggacgagatcgcgggcctcatcgaccgcgtcctcaccaccaccgagcccggc
accaccgccaagggcgccccctccaaggcccagcacgtcctggacccgaagatcgcggac
gagatcgcccaccgcgccggagacctgctgaccggcttcccgctctacccggagatcgac
ctcggctga

DBGET integrated database retrieval system