KEGG   Streptomyces avermitilis: SAVERM_2812Help
Entry
SAVERM_2812       CDS       T00126                                 

Gene name
prcB2
Definition
(GenBank) putative 20S proteasome beta-subunit
  KO
K03433  proteasome beta subunit [EC:3.4.25.1]
Organism
sma  Streptomyces avermitilis
Pathway
sma03050  Proteasome
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    SAVERM_2812 (prcB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sma01002]
    SAVERM_2812 (prcB2)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:sma03051]
    SAVERM_2812 (prcB2)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     SAVERM_2812 (prcB2)
Peptidases and inhibitors [BR:sma01002]
 Threonine peptidases
  Family T1: proteasome family
   SAVERM_2812 (prcB2)
Proteasome [BR:sma03051]
 Prokaryotic proteasome
  Core particles (20S proteasome)
   SAVERM_2812 (prcB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Proteasome
Motif
Other DBs
NCBI-ProteinID: BAC70523
NITE: SAV2812
UniProt: Q82JE3
Position
3453820..3454674
Genome map
AA seq 284 aa AA seqDB search
MAQRDTGGRLGAEFFTPGDSSFTAFLAAHRPALLSTRGLLPDGVRAAPDRVPHGTTVLAL
AYRDGVLIAGDRRATMGNLIAQRDLEKVHPADDYTAVAFAGTVGLALDMVKLYQVELAHF
EKVEGVPMTLRAKATRLAGMIRQNLGQAMQGLAVVPLLVGYDLAARAGEHGRIFSFDVTG
GPYEKTDFHAEGSGSPYARGALKKLFHPGMSRREAALAALQALYDAADDDSATGGPDISR
RIFPVVSVITEDGFERLPESETEDLSREMVEQRHTRPDGPTAAM
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggcacagcgcgacaccggtggccggttgggggcggagttcttcacccccggggactcg
tccttcaccgcgttcctggcagcccaccgtccggcattactgagcacccgcggcctcctc
ccggacggcgtccgggccgcgcccgaccgtgtcccgcacggcaccacggtcctggccctc
gcctaccgcgacggcgtgctgatcgccggcgaccgcagggccaccatggggaacctgatc
gcacagcgggacctggagaaggtgcaccccgcggacgactacacggcggtcgcgttcgcc
ggcaccgtgggactcgcgctggacatggtgaagctctaccaggtcgagctggcgcacttc
gagaaggtcgagggcgtcccgatgaccctcagggcgaaggcgacccggctggccggcatg
atccggcagaacctcggccaggccatgcagggcctcgccgtggtcccgctgctcgtcgga
tacgacctcgcggcccgcgccggcgaacacggccgcatcttcagcttcgacgtcaccgga
ggcccgtacgagaagacggacttccacgccgagggctccggctccccgtacgcccggggc
gcgttgaagaagctgttccatccgggcatgtcccggcgtgaggcggccctggccgcgctc
caggcgctctacgacgcggcggacgacgactcggccaccggcggtccggacatcagccgc
cggatcttccccgtggtgtccgtcatcacggaggacggcttcgagcggctcccggagtcc
gagacggaggacctgagccgggagatggtcgaacagcgccacacccgcccggacgggccc
accgccgccatgtga

KEGG   Streptomyces avermitilis: SAVERM_6681Help
Entry
SAVERM_6681       CDS       T00126                                 

Gene name
prcB1
Definition
(GenBank) putative 20S proteasome beta-subunit
  KO
K03433  proteasome beta subunit [EC:3.4.25.1]
Organism
sma  Streptomyces avermitilis
Pathway
sma03050  Proteasome
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    SAVERM_6681 (prcB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sma01002]
    SAVERM_6681 (prcB1)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:sma03051]
    SAVERM_6681 (prcB1)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     SAVERM_6681 (prcB1)
Peptidases and inhibitors [BR:sma01002]
 Threonine peptidases
  Family T1: proteasome family
   SAVERM_6681 (prcB1)
Proteasome [BR:sma03051]
 Prokaryotic proteasome
  Core particles (20S proteasome)
   SAVERM_6681 (prcB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Proteasome
Motif
Other DBs
NCBI-ProteinID: BAC74392
NITE: SAV6681
UniProt: Q828I8
Position
7992894..7993739
Genome map
AA seq 281 aa AA seqDB search
MEANTRSTGRLPAAFLTPGSSSFMDFLSEHQPEILPGNRQLPPTQGVIEAPHGTTIVATT
FPGGVVLAGDRRATMGNVIAQRDIEKVFPADEYSAVGIAGTAGLAVEMVKLFQLELEHFE
KVEGATLSLEGKANRLSTMIRSNLAMAMQGLAVVPLFAGYDVDREKGRIFSYDVTGGRSE
EHGYASTGSGSIFARGAMKKLYRDDLTEQQATTLVIQALYDAADDDSATGGPDVARRIYP
IVTVITEDGFRRLTDEESSEIARAILERRLEQPDGPRAALL
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
gtggaagccaacactcgtagcaccgggcgtctaccggctgccttcctgacacctgggtcg
tcgtccttcatggacttcctgtccgagcaccagccggagatcctcccgggcaaccggcag
ctgccgcccacccagggcgtgatcgaggccccgcacggcacgaccatcgtcgccaccacg
ttcccgggcggggtggtcctcgccggtgaccggcgggccaccatgggcaatgtcatcgca
cagcgcgacatcgagaaggtcttcccggccgacgagtactcggcggtgggcatcgccggt
acggcgggtctggccgtcgagatggtgaagctgttccagctggagctggagcacttcgag
aaggtcgagggtgccacgctctccctggagggcaaggcgaaccgcctctccacgatgatc
cgttccaacctcgccatggccatgcagggcctggccgtggtacccctcttcgcgggctac
gacgtggaccgcgaaaagggccgcatcttctcctacgacgtcaccggcggccgctccgag
gagcacggctacgcctccaccggctccggctcgatcttcgcgcgcggtgccatgaagaag
ctctaccgcgacgacctgaccgagcagcaggccacgacgctcgtcatccaggccctgtac
gacgcggccgacgacgactcggcgacaggcggtcccgatgtcgcccgccggatctacccg
atcgtcaccgtgatcaccgaagacggattccgccggctcaccgacgaggagtcctccgag
atcgcccgcgcgatcctggagcggcgcctggagcagcccgacggcccgcgggccgcgctg
ctctga

DBGET integrated database retrieval system