KEGG   Streptomyces avermitilis: SAVERM_2822
Entry
SAVERM_2822       CDS       T00126                                 

Gene name
pfkA1
Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
sma  Streptomyces avermitilis
Pathway
sma00010  Glycolysis / Gluconeogenesis
sma00030  Pentose phosphate pathway
sma00051  Fructose and mannose metabolism
sma00052  Galactose metabolism
sma00680  Methane metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
sma01230  Biosynthesis of amino acids
Module
sma_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAVERM_2822 (pfkA1)
   00030 Pentose phosphate pathway
    SAVERM_2822 (pfkA1)
   00051 Fructose and mannose metabolism
    SAVERM_2822 (pfkA1)
   00052 Galactose metabolism
    SAVERM_2822 (pfkA1)
  09102 Energy metabolism
   00680 Methane metabolism
    SAVERM_2822 (pfkA1)
Enzymes [BR:sma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SAVERM_2822 (pfkA1)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     SAVERM_2822 (pfkA1)
SSDB
Motif
Pfam: PFK NAD_kinase Pantoate_transf
Other DBs
NCBI-ProteinID: BAC70533
NITE: SAV2822
UniProt: Q82JD3
Position
complement(3466103..3467128)
AA seq 341 aa
MRIGVLTAGGDCPGLNAVIRSVVHRAVTMYGDEVIGFEDGYAGLLDGRYRALDLNAVSGI
LARGGTILGSSRLQRDRLREACENAQDMAREFGIDALIPIGGEGTLTAARMLSDAGLPVV
GVPKTIDNDISATDRTFGFDTAVGVATEAMDRLKTTAESHQRVMVVEVMGRHAGWIALES
GMAAGAHGICLPERPFDPAHLVKMVEERFARGKKFAVLCVAEGAHPVVGSMDYSHGAIDQ
FGHERFQGIGTALAAELEHRLGKEAKPVILGHIQRGGTPTAYDRVLATRFGWHAVEAAHR
GDFGRMTALRGTDVQMVPLAEAVTELKTVPKDRMDEAESVF
NT seq 1026 nt   +upstreamnt  +downstreamnt
atgcgtatcggagtactcaccgcaggcggcgactgcccaggcctgaacgcagtgatccgg
tcggtcgtgcaccgagcggtcacgatgtacggcgacgaggtcatcggcttcgaggacggc
tacgcgggcctgctcgacggccgctaccgcgccctcgacctcaacgcggtcagcggcatc
ctcgcccgcggcggcaccatcctcggctcctcccggctccagcgcgaccgcctgcgtgag
gcctgcgagaacgcgcaggacatggcccgcgagttcggcatcgacgcgctgatccccatc
ggcggcgaaggcaccctgaccgccgcccgcatgctctcggacgcgggcctgccggtcgtc
ggcgtcccgaagacgatcgacaacgacatctccgccacggaccgcaccttcggcttcgac
acggccgtgggcgtcgccacggaggcgatggaccgcctcaagacgaccgccgagtcccac
cagcgcgtgatggtcgtcgaggtcatgggccgccacgcgggctggatcgccctggagtcc
ggcatggccgccggcgcccacggcatctgcctgccggagcgccccttcgaccccgcccac
ctggtgaagatggtcgaggagcgcttcgcccgagggaagaagttcgccgtcctctgcgtc
gccgagggcgcgcaccccgtcgtgggcagcatggactacagccacggcgcgatcgaccag
ttcggccacgagcgcttccagggcatcggcacggccctcgcggccgagctggagcaccgc
ctcggcaaggaggccaagccggtcattctcggccacatccagcgcggcggcacgccgacc
gcgtacgaccgggtgctcgcgacccgcttcggctggcacgcggtcgaggccgcgcaccgc
ggggacttcggcaggatgacggcgctgcgcggcacggacgtccagatggtgccgctggcg
gaggcggtcacggagctgaagacggtgccgaaggaccggatggacgaggcggagtcggtc
ttctag

KEGG   Streptomyces avermitilis: SAVERM_6083
Entry
SAVERM_6083       CDS       T00126                                 

Gene name
pfkA2
Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
sma  Streptomyces avermitilis
Pathway
sma00010  Glycolysis / Gluconeogenesis
sma00030  Pentose phosphate pathway
sma00051  Fructose and mannose metabolism
sma00052  Galactose metabolism
sma00680  Methane metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
sma01230  Biosynthesis of amino acids
Module
sma_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAVERM_6083 (pfkA2)
   00030 Pentose phosphate pathway
    SAVERM_6083 (pfkA2)
   00051 Fructose and mannose metabolism
    SAVERM_6083 (pfkA2)
   00052 Galactose metabolism
    SAVERM_6083 (pfkA2)
  09102 Energy metabolism
   00680 Methane metabolism
    SAVERM_6083 (pfkA2)
Enzymes [BR:sma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SAVERM_6083 (pfkA2)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     SAVERM_6083 (pfkA2)
SSDB
Motif
Pfam: PFK NAD_kinase CbiG_N
Other DBs
NCBI-ProteinID: BAC73794
NITE: SAV6083
UniProt: Q82AH4
Position
7319161..7320189
AA seq 342 aa
MRVGVLTGGGDCPGLNAVIRGVVRKGVQEYGYDFVGFRDGWRGPLEGDAVRLDIPAVRGI
LPRGGTILGSSRTNPLKLDDGIRRIKENLAKQEVDALIAIGGEDTLGVAARLTDEYGVPV
VGVPKTIDNDLSATDYTFGFDTAVGIATEAIDRLHTTAESHMRVLVCEVMGRHAGWIAIH
SGLAGGANVILIPEQRFDVDQVCAYVTSRFKASYAPIVVVAEGAMPKDGQMVLKDESLDS
FGHVRLSGVGEWLAKEIEKRTGKEARTTVLGHVQRGGTPSAFDRWLATRFGLHAIEAVRD
GDFGKMVALRGTDIVRVPIAEATAKLKTVDPKLYEEVGVFFG
NT seq 1029 nt   +upstreamnt  +downstreamnt
atgcgggtcggagtactgaccggaggcggcgactgccccgggctcaacgccgtcatccgg
ggcgtcgtccgtaagggcgtgcaggagtacggctacgacttcgtcggcttccgggacggc
tggcggggaccactcgaaggcgacgccgtacggctcgacatccccgcggtgcgcggcatc
ctgccccgcggcggcacgatcctcggctcctcgcgcaccaaccccctcaagctcgacgac
ggcatccgccggatcaaggagaacctcgccaagcaggaggtcgacgcgctcatcgcgatc
ggcggcgaggacacgctcggcgtcgccgcacgcctcaccgacgagtacggcgtgcccgtc
gtcggcgtcccgaagaccatcgacaacgacctgtcggccaccgactacacgttcggcttc
gacacggccgtcggcatcgcgaccgaggccatcgaccgcctccacaccaccgccgagtcc
cacatgcgcgtcctcgtctgcgaggtgatgggccggcacgcgggctggatcgccatccac
tcgggcctggccggcggcgccaacgtcatcctcatccccgagcagcgcttcgacgtcgac
caggtgtgcgcctatgtgacctcgcggttcaaggcctcgtacgcgccgatcgtggtcgtc
gccgagggcgcgatgcccaaggacggccagatggtcctcaaggacgagtccctcgactcc
ttcggccacgtgcgcctctccggggtcggcgagtggctggccaaggagatcgagaagcgc
accggcaaggaggcccgcaccacggtcctcgggcatgtgcagcgcggcggcacgccgagc
gcgttcgaccgctggctcgccacccgcttcggcctgcacgccatcgaggccgtccgcgac
ggcgacttcggcaagatggtcgccctgcgcggcacggacatcgtccgtgtcccgatcgcg
gaggccacggcgaagctgaagacggtcgatccgaagctgtacgaggaggtcggggtcttc
ttcggctga

KEGG   Streptomyces avermitilis: SAVERM_7123
Entry
SAVERM_7123       CDS       T00126                                 

Gene name
pfkA3
Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
sma  Streptomyces avermitilis
Pathway
sma00010  Glycolysis / Gluconeogenesis
sma00030  Pentose phosphate pathway
sma00051  Fructose and mannose metabolism
sma00052  Galactose metabolism
sma00680  Methane metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
sma01230  Biosynthesis of amino acids
Module
sma_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAVERM_7123 (pfkA3)
   00030 Pentose phosphate pathway
    SAVERM_7123 (pfkA3)
   00051 Fructose and mannose metabolism
    SAVERM_7123 (pfkA3)
   00052 Galactose metabolism
    SAVERM_7123 (pfkA3)
  09102 Energy metabolism
   00680 Methane metabolism
    SAVERM_7123 (pfkA3)
Enzymes [BR:sma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SAVERM_7123 (pfkA3)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     SAVERM_7123 (pfkA3)
SSDB
Motif
Pfam: PFK NAD_kinase
Other DBs
NCBI-ProteinID: BAC74834
NITE: SAV7123
UniProt: Q826Q3
Position
complement(8483551..8484576)
AA seq 341 aa
MRIGVLTSGGDCPGLNAVIRSVVHRAVVDHGDEVIGFRDGWKGLLECDYLKLDLDAVSGI
LARGGTILGSSRVQPAHLRDGVERARGHVAELGLDAIIPIGGEGTLKAARLLSDAGLPIV
GVPKTIDNDIAVTDVTFGFDTAVGVATEALDRLKTTAESHQRVLIVEVMGRHTGWIALHS
GMAAGAHAIVVPERPFDIEELAAKVGERFEAGKRFAIVVAAEGAKPRAGSMDFDEGKKDV
YGHERFAGIARQLSLELEERLGKEARPVILGHVQRGGTPTAYDRVLATRFGWHAVEAVHR
GEFGKMTALRGTDIVMVSLAEAVETLKTVPEERYAEAECVL
NT seq 1026 nt   +upstreamnt  +downstreamnt
atgcgcattggtgtcctcacgtccggtggcgactgccccggcctgaacgccgtcatccgg
tccgtcgtgcaccgggccgtcgtcgaccacggcgacgaggtcatcggcttccgggacggc
tggaagggcctcctggagtgcgactacctcaagctcgacctcgacgcggtgagcggaatc
ctggctcgcggcggcaccatcctcggctcctcccgggtccagccggcgcatctgcgtgac
ggcgtggagcgggccaggggccatgtcgcggagctcggcctcgacgcgatcatcccgatc
ggcggcgagggcacgctcaaggcggcccgcctcctgtcggacgccggcctgccgatcgtc
ggcgtgccgaagaccatcgacaacgacatcgcggtcaccgacgtgaccttcggtttcgac
accgccgtgggcgtcgcgaccgaggcgctcgaccggctgaagaccaccgccgagtcccac
cagcgcgtcctcatcgtggaggtcatgggccgccacaccggctggatcgcgctgcactcg
ggcatggcggcgggcgcccacgccatcgtcgtaccggaacgccccttcgacatcgaggaa
ctggccgccaaggtcggcgagcgcttcgaggcgggcaagcggttcgcgatcgtggtggcc
gccgagggcgccaagccccgtgcgggctcgatggacttcgacgagggcaagaaggacgtc
tacggccacgagcgcttcgccggcatcgcccgccagctctccctggagctggaggagcgc
ctcggcaaggaggcccggccggtgatcctcggacatgtccagcgcggcggcactccgacg
gcgtacgaccgcgtcctcgcgacccgtttcggctggcatgccgtggaggccgtgcaccgg
ggcgagttcggcaagatgaccgcgctgcgcggcaccgacatcgtgatggtctcgctcgcc
gaggcggtcgagacgctgaagacggtccccgaggagcggtacgccgaggcggagtgcgtc
ctgtaa

DBGET integrated database retrieval system