KEGG   Streptomyces avermitilis: SAVERM_2824
Entry
SAVERM_2824       CDS       T00126                                 

Gene name
ackA
Definition
(GenBank) putative acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
sma  Streptomyces avermitilis
Pathway
sma00430  Taurine and hypotaurine metabolism
sma00620  Pyruvate metabolism
sma00640  Propanoate metabolism
sma00680  Methane metabolism
sma01100  Metabolic pathways
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
Module
sma_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAVERM_2824 (ackA)
   00640 Propanoate metabolism
    SAVERM_2824 (ackA)
  09102 Energy metabolism
   00680 Methane metabolism
    SAVERM_2824 (ackA)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    SAVERM_2824 (ackA)
Enzymes [BR:sma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     SAVERM_2824 (ackA)
SSDB
Motif
Pfam: Acetate_kinase
Other DBs
NCBI-ProteinID: BAC70535
NITE: SAV2824
UniProt: Q82JD1
Position
3469412..3470629
AA seq 405 aa
MSPTRVLVLNSGSSSVKYQLLDMRDSSRLAVGLVERIGEGTSRLKHTPLTTGVSRELTSP
VADHAAALKTVAEELAKDGLGLDSPELAAIGHRVVHGGRSFTEPTVIDDDVLAEIERLIP
VAPLHNPANLTGIRTAMALRPDLPQVAVFDTAFHTTMPESAARYAIDVKTADEHRVRRYG
FHGTSHAYVSRATAKLLGRAPKDVNLIVLHLGNGASASAVRGGRCVDTSMGLTPLEGLVM
GTRSGDMDPAVIFHLMRVGGMSTDEVDTLLNTKSGLIGLCGDNDMREIRRRVDEGDEQAA
LAFDIYIHRLKKYIGAYYAVLGRVDAVAFTAGVGENAAPVRAAAIAGLEELGLVVDSERN
AVRSDEPRIVSPEDARVAVAVVPTDEELEIAQQTYALVGTAHHLT
NT seq 1218 nt   +upstreamnt  +downstreamnt
gtgagcccgacccgcgtcctcgtcctcaactccggctcctcgtcggtgaagtaccagctg
ctcgacatgcgggacagcagccggctggccgtgggtctggtcgagcgcatcggtgagggg
acctcccggctgaagcacacgccgctcaccacgggtgtctcccgggagctgaccagcccg
gtcgccgaccacgcggccgccctcaagaccgtcgccgaggagctggcgaaggacgggctc
ggcctggactcccccgagctggcggcgatcggccaccgcgtggtgcacggcggcaggtcc
ttcaccgagccgaccgtcatcgacgacgacgtcctcgccgagatcgagcggctgatcccc
gtggcgccgctgcacaacccggccaacctcaccggcatccgcaccgccatggcgctgcgc
ccggacctcccccaggtcgccgtcttcgacaccgccttccacacgacgatgccggagtcg
gcggcgcgctacgcgatcgacgtgaagacggccgacgagcaccgcgtccggcgctacggc
ttccacggcacctcgcacgcgtatgtgtcccgggcgaccgcgaagctcctgggcagggcg
ccgaaggacgtgaacctgatcgtgctgcacctgggcaacggcgcctccgcgtcggccgtg
cgcggtgggcgctgcgtggacacctccatggggctgacccccttggaggggctggtgatg
ggtacgcgctccggtgacatggatccggccgtcatcttccatttgatgcgggtcggcgga
atgtccacggacgaggtcgacactctgctcaacacgaagagcggtctgatcggcctgtgc
ggcgacaacgacatgcgggagatccgccgccgtgtcgacgagggcgacgagcaggcggcg
ctcgccttcgacatctacattcaccgactgaagaagtacataggcgcctactacgcggtc
ctcggccgggtggacgcggtcgcgttcacggccggggtcggcgagaacgcggccccggtg
cgcgcggccgcgatcgcgggcctggaggaactggggctggtggtcgacagcgagcgcaac
gccgtacggagcgacgagccgcggatcgtctcgcccgaggacgcgcgggtcgcggtcgcg
gtggtgccgaccgacgaggaactggagatcgcccagcagacgtacgccctcgtgggcacg
gcgcaccacctcacctga

DBGET integrated database retrieval system