KEGG   Streptomyces avermitilis: SAVERM_2857
Entry
SAVERM_2857       CDS       T00126                                 

Definition
(GenBank) hypothetical protein
  KO
K05606  methylmalonyl-CoA/ethylmalonyl-CoA epimerase [EC:5.1.99.1]
Organism
sma  Streptomyces avermitilis
Pathway
sma00280  Valine, leucine and isoleucine degradation
sma00630  Glyoxylate and dicarboxylate metabolism
sma00640  Propanoate metabolism
sma01100  Metabolic pathways
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
Module
sma_M00741  Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SAVERM_2857
   00640 Propanoate metabolism
    SAVERM_2857
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAVERM_2857
Enzymes [BR:sma01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.99  Acting on other compounds
    5.1.99.1  methylmalonyl-CoA epimerase
     SAVERM_2857
SSDB
Motif
Pfam: Glyoxalase_4 Glyoxalase_3 Glyoxalase Glyoxalase_6
Other DBs
NCBI-ProteinID: BAC70568
NITE: SAV2857
UniProt: Q82JA8
Position
3499939..3500430
AA seq 163 aa
MIARTLRNHLPERCTDSMLTRIDHIGIACFDLDRTVEFYRATYGFEVFHSEVNEEQGVRE
AMLKINNTDDGGASYLQLLEPTREDSAVGKWLAKNGEGVHHIAFGTADVDADAADIREKG
VRVLYDEPRRGSMGSRITFLHPKDCHGVLTELVTSAAVESPEH
NT seq 492 nt   +upstreamnt  +downstreamnt
gtgatcgcgcgcacgttgcgtaaccacctcccggagcgctgcactgactccatgctgacg
cgaatcgaccacatcgggatcgcctgtttcgacctcgacaggaccgtcgagttctaccgg
gccacatacggcttcgaggtgttccactccgaggtcaacgaagagcagggcgtgcgcgag
gccatgctcaagatcaacaacacggacgacgggggcgcttcctacctccagctcctggaa
cccacccgcgaggactccgccgtcgggaagtggctggcgaagaacggagagggcgttcac
cacattgctttcggtacggcggatgtggacgcggacgccgccgacatcagggaaaagggc
gtacgcgtcctgtatgacgagccccggcggggctccatggggtcccggatcacgttcctg
catccaaaggattgccacggagtactgacagaactggtcacttcggcggctgttgagtca
cctgagcactga

DBGET integrated database retrieval system