KEGG   Streptomyces avermitilis: SAVERM_2870
Entry
SAVERM_2870       CDS       T00126                                 

Gene name
fadC3
Definition
(GenBank) putative 3-hydroxyacyl-CoA dehydrogenase
  KO
K00074  3-hydroxybutyryl-CoA dehydrogenase [EC:1.1.1.157]
Organism
sma  Streptomyces avermitilis
Pathway
sma00360  Phenylalanine metabolism
sma00362  Benzoate degradation
sma00650  Butanoate metabolism
sma01100  Metabolic pathways
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SAVERM_2870 (fadC3)
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    SAVERM_2870 (fadC3)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAVERM_2870 (fadC3)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.157  3-hydroxybutyryl-CoA dehydrogenase
     SAVERM_2870 (fadC3)
SSDB
Motif
Pfam: 3HCDH_N 3HCDH NAD_binding_2 F420_oxidored adh_short_C2 NAD_Gly3P_dh_N DAO UDPG_MGDP_dh_N AlaDh_PNT_C
Other DBs
NCBI-ProteinID: BAC70581
NITE: SAV2870
UniProt: Q82J95
Position
complement(3516433..3517281)
AA seq 282 aa
MTGKLAVIGAGLMGSGIAQVSAQAGWDVVLRDVTDEALTRGTDGIKASYDKFVSKGRLSA
DDAGAALARITTTTDLDAVADADIVVEAVFEKLEVKHEIFRALDKIVRDETVLASNTSAI
PITKIAAVTERPERVVGAHFFSPVPMMQLCELVRGYKTSDEALATTREFAESVGKTCIVV
NRDVAGFVTTRLISALVVEAAKLYESGVATAEDIDLACKLGFGHAMGPLATADLTGVDIL
LHATSNIYTESQDEKFAPPELMRRMVDAGDIGRKSGQGFYKH
NT seq 849 nt   +upstreamnt  +downstreamnt
gtgacagggaagctcgccgtcatcggagccggactcatgggttccggtatcgcccaggtc
tccgcccaggccggctgggacgtcgtcctgcgcgacgtcaccgacgaggcgctgacccgc
ggcaccgacggcatcaaggcctcgtacgacaagttcgtcagcaagggcaggctgtcggcc
gacgacgccggggccgccctcgcgcgcatcaccacgaccaccgatctggacgcggtcgcc
gacgccgacatcgtcgtcgaggccgtcttcgagaagctggaggtcaagcacgagatcttc
cgcgcgctcgacaagatcgtgcgggacgagaccgtgctcgcctccaacacctccgccatc
ccgatcaccaagatcgccgcggtgacggagcgcccggagcgcgtcgtcggcgcgcacttc
ttctcgccggtcccgatgatgcagctgtgcgagctggtccgcggctacaagacgagcgac
gaggccctcgccaccacgcgggagttcgccgagtccgtcggcaagacctgcatcgtcgtc
aaccgcgatgtcgccggttttgtgacgacccgtctcatctcggcgctcgtcgtcgaggcg
gcgaagctgtacgaatcgggcgtggccaccgccgaggacatcgacctcgcctgcaagctg
ggcttcggtcacgccatgggccccctcgccaccgccgacctcaccggcgtcgacatcctg
ctgcacgccaccagcaacatctacaccgagtcccaggacgagaagttcgccccgccggag
ctgatgcgccggatggttgacgccggtgacatcggacgcaagagcgggcagggcttctac
aagcactga

KEGG   Streptomyces avermitilis: SAVERM_4359
Entry
SAVERM_4359       CDS       T00126                                 

Gene name
paaH
Definition
(GenBank) putative 3-hydroxyacyl-CoA dehydrogenase
  KO
K00074  3-hydroxybutyryl-CoA dehydrogenase [EC:1.1.1.157]
Organism
sma  Streptomyces avermitilis
Pathway
sma00360  Phenylalanine metabolism
sma00362  Benzoate degradation
sma00650  Butanoate metabolism
sma01100  Metabolic pathways
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SAVERM_4359 (paaH)
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    SAVERM_4359 (paaH)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAVERM_4359 (paaH)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.157  3-hydroxybutyryl-CoA dehydrogenase
     SAVERM_4359 (paaH)
SSDB
Motif
Pfam: 3HCDH_N 3HCDH 3HCDH_RFF NAD_binding_2 F420_oxidored 2-Hacid_dh_C NAD_Gly3P_dh_N
Other DBs
NCBI-ProteinID: BAC72071
NITE: SAV4359
UniProt: Q82FA0
Position
5336984..5338498
AA seq 504 aa
MTALDLSSPVAVVGTGTMGQGIAQVALVAGHPVRLYDAVPGRAQEAADAIGARLDRLVEK
DRLAAADRDAARARLRPAADLADLADCFLVVEAVLERLDVKQQLLRELEDVVEDDCLLAT
NTSSLSVTAIGGALRNPGRFVGLHFFNPAPLLPLVEVVSGFATDVTSATRAYETARAWGK
TPVACADTPGFIVNRIARPFYAEAFAVYEAQAADPATIDAILRESGGFRMGAFELTDLIG
QDVNESVTHSVWQAFFQDVRFTPSLAQRRLVESGRHGRKTGQGWYDYGEAAERPEPHTAE
KAQAPAYVVVEGDLGPASELLALIREAGIQIREDEEDHGTRLVLPSGGQLVLADGQTSVE
FRDVVYFDLALDYRRATRIALSASQDTAPATVAEATGLFQALGKDVSVIGDVPGMIVART
VARIVDLAHDAVAKGVATEEDIDTAMRLGVNYPLGPFEWCRRLGRVWAHDLLEELSLREP
SGRYAPSLALYRHGHAADKREGTS
NT seq 1515 nt   +upstreamnt  +downstreamnt
atgacagcactcgacctcagcagcccggtggccgtcgtcggcaccggcaccatgggccag
ggcattgcccaggtcgcgctggtcgcgggccaccccgtgcggctgtacgacgccgttccc
ggccgcgctcaggaagcggccgacgcgatcggtgcccgcctcgaccggctcgtcgagaag
gaccgcctagccgcggccgaccgggacgcggcacgggcccgcctgcggcccgccgccgac
ctcgccgacctcgcggactgcttcctcgtcgtcgaggccgtcctggagcggctcgacgtg
aaacagcagctgctgcgcgagctggaggacgtcgtcgaggacgactgcctgctcgccacc
aacacctcgtccctgtccgtcacggccatcggcggcgccctgcgcaaccccggccgcttc
gtgggcctgcacttcttcaaccccgcgccgctgctgcccctcgtcgaggtcgtctccggg
ttcgccaccgacgtcacctcggccacgcgcgcgtacgagacggcacgggcctggggcaag
accccggtcgcctgcgccgacacccccggcttcatcgtcaaccgcatcgcgcggcccttc
tacgccgaggccttcgcggtgtacgaggcccaggccgccgaccccgccaccatcgacgcg
atcctgcgcgagtcgggcggcttccggatgggcgccttcgaactgaccgacctcatcggc
caggacgtcaacgagtccgtcacgcactccgtgtggcaggccttcttccaggacgtccgc
ttcacgccctcgctcgcgcaacggcggctcgtcgagtcgggccggcacggccgcaagacg
gggcagggctggtacgactacggggaggccgccgagcgccccgaaccgcacaccgcggag
aaggcgcaggcgcccgcgtacgtcgtcgtcgagggcgacctgggcccggcttccgaactg
ctcgcgctgatccgcgaggcgggtatccagatccgcgaggacgaggaggaccacggcacg
cggctggtactgccgagcggcggccagctggtcctcgccgacggccagacctccgtcgag
ttccgggacgtcgtctacttcgacctggcgctcgactaccgcagggcgacccgcatcgcc
ctgtccgcctcccaggacaccgccccggcgaccgtcgccgaggcgaccgggctgttccag
gcgctcggcaaggacgtcagcgtcatcggggacgtgcccggcatgatcgtcgcccgcacc
gtggcccgcatcgtcgacctggcgcacgacgccgtcgccaagggagtggccaccgaggag
gacatcgacacggcgatgcgcctgggcgtcaactaccccctggggcccttcgaatggtgc
cgcaggctgggcagggtctgggcgcacgacctcctggaggagctgagcctgcgcgaaccc
tccggtcgctatgcgccctctctcgcgctgtaccgccacgggcatgccgccgacaagcgg
gagggcacctcatga

KEGG   Streptomyces avermitilis: SAVERM_6748
Entry
SAVERM_6748       CDS       T00126                                 

Gene name
fadC5
Definition
(GenBank) putative 3-hydroxyacyl-CoA dehydrogenase
  KO
K00074  3-hydroxybutyryl-CoA dehydrogenase [EC:1.1.1.157]
Organism
sma  Streptomyces avermitilis
Pathway
sma00360  Phenylalanine metabolism
sma00362  Benzoate degradation
sma00650  Butanoate metabolism
sma01100  Metabolic pathways
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SAVERM_6748 (fadC5)
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    SAVERM_6748 (fadC5)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAVERM_6748 (fadC5)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.157  3-hydroxybutyryl-CoA dehydrogenase
     SAVERM_6748 (fadC5)
SSDB
Motif
Pfam: 3HCDH_N 3HCDH NAD_binding_2 F420_oxidored 2-Hacid_dh_C NAD_binding_7 NAD_Gly3P_dh_N Sacchrp_dh_NADP
Other DBs
NCBI-ProteinID: BAC74459
NITE: SAV6748
UniProt: Q828C1
Position
complement(8066129..8067010)
AA seq 293 aa
MISERDDVTDIERVGVVGCGQMGAGIAEVCARAGLDVKVAETTGEALEIGRTRLFNSLSK
AAERGKISEEERDATQARLSFTTDLGEFADRDLVIEAVVENEQVKTEIFQVLDQVVTRPD
AILASNTSSIPLVKLAVATSRPDQVIGIHFFNPAPVQKLVELIPALTTSEGTLSRAQGLV
EKILGKHAIRAQDRSGFVVNALLIPYLLSAIRMFESGIASREDIDNGMELGCAHPMGPLK
LSDLIGLDTVASVASSMYEEYKEPLYAAPPLLQRMVDAGRLGRKSGSGFYSYA
NT seq 882 nt   +upstreamnt  +downstreamnt
atgatcagcgaaagggacgatgtgaccgacatcgaacgcgtcggagtggtcggctgcggc
cagatgggagcgggcatcgccgaggtgtgcgcccgcgccggtcttgacgtcaaggtcgcc
gagaccaccggcgaggccctggagatcggccggacccgtctgttcaactcgctgtccaag
gcggccgagcgcggcaagatctccgaggaggagcgggacgcgacgcaggcccggctcagc
ttcaccaccgacctcggcgagttcgcggaccgcgatctggtgatcgaggccgtcgtcgag
aacgagcaggtgaagacggagatcttccaggtgctcgaccaggtggtgacccggccagac
gcgatcctcgcctccaacacctcctcgatcccgctggtgaagctcgccgtcgccacctcg
cgccccgaccaggtcatcggcatccacttcttcaacccggccccggtgcagaagctcgtc
gagctgatcccggccctcaccacctccgagggcaccctcagccgcgcgcaggggctcgtc
gagaagatcctcggcaagcacgcgatccgcgcccaggaccgctccggcttcgtggtcaac
gccctcctcatcccgtatctgctctccgcgatccggatgttcgagtcgggcatcgccagc
cgtgaggacatcgacaacggcatggagctgggctgcgcccatccgatgggcccgctcaag
ctgtccgacctgatcggcctggacacggtggcctcggtcgcgtcgtcgatgtacgaggag
tacaaggaaccgctgtacgccgctcccccgctgctccagcgcatggtggacgcgggccgg
ctgggccggaagtcgggctcgggcttctactcctacgcctga

DBGET integrated database retrieval system