KEGG   Streptomyces avermitilis: SAVERM_2917
Entry
SAVERM_2917       CDS       T00126                                 

Gene name
thrC1
Definition
(GenBank) putative threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
sma  Streptomyces avermitilis
Pathway
sma00260  Glycine, serine and threonine metabolism
sma00750  Vitamin B6 metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01230  Biosynthesis of amino acids
Module
sma_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAVERM_2917 (thrC1)
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SAVERM_2917 (thrC1)
Enzymes [BR:sma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SAVERM_2917 (thrC1)
SSDB
Motif
Pfam: PALP ACP_syn_III_C PK_C
Other DBs
NCBI-ProteinID: BAC70628
NITE: SAV2917
UniProt: Q82J65
Position
complement(3650076..3651134)
AA seq 352 aa
MTHQWRGIIEEYRDRLPVSDSTPVVTLREGGTPLVPAQVLSERTGCEVHLKVEGANPTGS
FKDRGMTMAITRAKEEGAKAVICASTGNTSASAAAYAVRAGMVCAVLVPQGKIALGKMGQ
ALVHGAKILQVDGNFDDCLTLARNLSDNYPVALVNSVNPVRIEGQKTAAFEIVDMLGDAP
DIHVLPVGNAGNITAYWKGYQEYAADGIARHKPRMWGFQASGSAPIVRGEVVKDPSTIAT
AIRIGNPASWKFALAAKDESGGFIDEVTDREILRAYRLLAAQEGVFVEPASAASVAGLLK
AAEQGKVDPGQTIVCTVTGNGLKDPDWAVAGAPQPVTVPVDAATAAERLGLA
NT seq 1059 nt   +upstreamnt  +downstreamnt
atgacccaccagtggcgcggaatcatcgaggagtaccgggaccggctgcccgtctccgac
agtacgccggtcgtgacgctccgtgagggcgggacgccgctcgtgcccgcgcaggtgctc
tccgagcgcacgggctgcgaggtccacctcaaggtggagggcgccaaccccaccgggtcc
ttcaaggaccgcggcatgaccatggccatcacgcgggccaaggaggagggcgcgaaggcg
gtcatctgcgcctccaccggcaacacgtcggcctccgccgccgcgtacgccgtacgcgcg
ggcatggtctgcgccgtgctcgtcccgcagggcaagatcgccctcggcaagatgggccag
gccctcgtgcacggcgcgaagatcctccaggtcgatggcaacttcgacgactgcctcacc
ctcgcgcgcaacctgtccgacaactacccggtggcgctggtcaattcggtcaacccggtg
cgtatcgaggggcagaagaccgcggcgttcgagatcgtcgacatgctcggtgacgcgccc
gacatccacgtcctcccggtcggcaacgcgggcaacatcaccgcgtactggaagggctat
caggagtacgccgccgacggcatcgcccgccacaagccccgtatgtggggcttccaggca
tccggctccgccccgatcgtgcgtggcgaggtcgtcaaggacccgtcgaccatcgccacc
gcgatccgtatcggcaacccggcgtcctggaagttcgcgctggcggcgaaggacgaatcc
ggcggtttcatcgacgaggtgacggaccgtgagattctgcgcgcctaccggctgttggcc
gcgcaggagggcgtcttcgtcgagcccgcgtccgccgcgtccgtcgccggtctgctgaag
gccgccgagcagggcaaggtcgacccgggccagaccatcgtctgcacggtcaccggcaac
ggcctcaaggaccccgactgggccgtcgcgggcgctccgcagccggtcacggtcccggtc
gacgcggccacggcggccgagcggctcgggctcgcgtaa

KEGG   Streptomyces avermitilis: SAVERM_3191
Entry
SAVERM_3191       CDS       T00126                                 

Gene name
thrC2
Definition
(GenBank) putative threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
sma  Streptomyces avermitilis
Pathway
sma00260  Glycine, serine and threonine metabolism
sma00750  Vitamin B6 metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01230  Biosynthesis of amino acids
Module
sma_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAVERM_3191 (thrC2)
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SAVERM_3191 (thrC2)
Enzymes [BR:sma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SAVERM_3191 (thrC2)
SSDB
Motif
Pfam: PALP PTH2
Other DBs
NCBI-ProteinID: BAC70902
NITE: SAV3191
UniProt: Q82IF6
Position
3973434..3974567
AA seq 377 aa
MTPLPDYFCPADGTRVPGGSLDWCCPACRGPLDLDFAPTPGPLKSLGGRVNSLWRYAECL
PLAAPTTSLGEGRTPLVSLTDGVAAKLDFLMPTLSFKDRGAVLLAELALQLRPRQVVADS
SGNAGTAIAAYCARAALPCTVYVPEGTSAKKLEQIEAHGARLRVVEGDREATAHAAREAA
DEAGVFYASHVFNPYFLHGTKTYVHELWEDLGGRLPDALVVPVGNGTLLLGAALAVAELH
AAGLIDRRPALYAVQAAAVAPLAHAWEQGADDLVGVTPAAPTFAEGIAIPRPPRARQILR
AVRESGGAFLTVTEDQIRHAQSDLASRGLYVESTGVACWAAVRAGALPQPRPRPGEGMPA
AVVPLCGAGLKTGPARA
NT seq 1134 nt   +upstreamnt  +downstreamnt
atgactcctttgccggattacttctgcccggcggacggcacgcgcgtccccggcggctcc
ctcgactggtgctgccccgcctgccgcgggccgctggacctggacttcgcccccacgccc
gggcccctcaagtccctcggcgggcgcgtgaactcgctgtggcggtacgcggagtgcctg
ccgctcgcggcgccgacgacgagtctcggtgagggccgtaccccgctcgtgtccctgacg
gacggcgtcgcggccaagctcgacttcctgatgccgaccctgtcgttcaaggaccggggc
gcggtgctgctggccgaactggcgctgcagctgcggccccggcaggtcgtcgcggacagc
agcggcaacgcgggtaccgcgatcgccgcgtactgcgcacgggccgccctgccgtgcacg
gtctacgtccccgagggcacgtcagcgaagaagctggagcagatcgaggcgcacggggcc
cggctgcgggtggtcgagggcgaccgcgaggcgacggcgcatgcggcgcgggaggccgcg
gacgaggcgggcgtcttctacgcgtcgcacgtcttcaacccgtacttcctgcacggcacc
aagacctatgtccacgagctctgggaggacctcggcggacggctcccggacgcgctcgtc
gtgcccgtcggcaacggcacgctgctcctcggcgccgcccttgccgtcgccgagctgcac
gcggcgggtctcatcgaccggcggcccgcgctgtacgccgtccaggccgcggcggtcgca
ccgctggcccacgcctgggagcagggcgcggacgacctggtcggggtcaccccggcggcc
cccacgttcgcggagggcatcgcgatcccccgcccgccgcgggcccgtcagatcctgcgg
gcggtacgcgagtccggtggcgccttcctgacggtgacggaggatcagatcaggcacgcg
cagagcgacttggcgtcgcggggactgtacgtcgagtcgacgggcgtggcgtgctgggcg
gccgtgcgcgcgggcgcgctgccccagccccggccgcgtccgggcgagggaatgcccgcg
gcggtcgtaccgctgtgcggggcggggctgaagacgggaccggcgcgggcgtaa

KEGG   Streptomyces avermitilis: SAVERM_3934
Entry
SAVERM_3934       CDS       T00126                                 

Gene name
thrC3
Definition
(GenBank) putative threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
sma  Streptomyces avermitilis
Pathway
sma00260  Glycine, serine and threonine metabolism
sma00750  Vitamin B6 metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01230  Biosynthesis of amino acids
Module
sma_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAVERM_3934 (thrC3)
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SAVERM_3934 (thrC3)
Enzymes [BR:sma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SAVERM_3934 (thrC3)
SSDB
Motif
Pfam: PALP DNA_RNApol_7kD UPF0547
Other DBs
NCBI-ProteinID: BAC71646
NITE: SAV3934
UniProt: Q82GG3
Position
complement(4857164..4858462)
AA seq 432 aa
MAAQTVASTSVTSPANSVDLGPAAALSCRECGHRVPLGPVFACDECFGPLEIAYDFSGYD
TEELRKQIEAGPANIWRYAPLLPVPADVAEKPNINPGWTKLVQADNLARELGVDAGKLFV
KDDSGNPTHSFKDRVVAQAIEAARAFDFTTLSCSSTGNLAGAVGAAAARAGFRSCVFIPH
DLEQGKVVMAAVYGGELVGIEGNYDDVNRFCSELIGDPAGEGWGFVNVNLRPYYAEGSKT
LAYEICEQLGWRLPDQLVVPIASGSQLTKIDKGLQELIKLGLVEDKPYKIFGAQAEGCSP
VSVAYKAGQDVVRPQKPNTIAKSLAIGNPADGPYVLDIARRTGGAVEDVNDEQIVDAIKL
LARTEGIFAETAGGVTVGVAKKLIESGLLDPTLTTVVLNTGDGLKTLDAVAGTGLTATIR
PSLDSFREAGLA
NT seq 1299 nt   +upstreamnt  +downstreamnt
atggctgcgcagactgtcgcaagtacctccgtcacctcccccgcgaactccgtcgacctc
ggtccggccgccgcgctttcctgccgcgagtgcggccaccgcgtgcccctcggtccggtc
ttcgcctgcgacgagtgtttcggcccgctggagatcgcgtacgacttctcgggctacgac
accgaggaactccgcaagcagatcgaggcgggccccgcgaacatctggcgctatgcgccg
ctcctgccggtcccggcggacgtcgccgagaagcccaacatcaacccgggctggaccaag
ctcgtccaggccgacaacctggcgcgtgagctcggtgtcgacgccggcaagctcttcgtg
aaggacgactccggcaacccgacgcactccttcaaggaccgcgtcgtcgcccaggccatc
gaggccgcccgcgccttcgacttcaccaccctctcctgctcctccaccggcaacctggcc
ggcgcggtgggcgccgccgccgcccgcgccggcttccgttcctgcgtgttcatcccgcac
gacctggagcagggcaaggtcgtcatggccgcggtctacggcggcgagctcgtcggcatc
gagggcaactacgacgacgtgaaccgcttctgctccgagctgatcggcgacccggccggc
gagggctggggcttcgtcaacgtcaacctgcggccgtactacgccgagggctccaagacg
ctggcgtacgagatctgcgagcagctcggctggcggctgccggaccagctggtggtgccc
atcgcctccggctcccagctcacgaagatcgacaaggggctccaggagctgatcaagctc
gggctggtcgaggacaagccgtacaagatcttcggcgcgcaggccgagggctgctcgccg
gtgtccgtcgcctacaaggccggccaggacgtcgtgcggccgcagaagccgaacaccatc
gccaagtcgctggccatcggcaacccggccgacggcccgtacgtcctcgacatcgcgcgc
cgcacgggcggtgcggtggaggacgtgaacgacgagcagatcgtcgacgcgatcaagctg
ctcgcacggaccgagggcatcttcgcggagaccgcgggtggcgtgacggtgggtgtggcc
aagaaactgatcgagagcggtctgctcgaccccaccctcacgacggtcgtcctcaacacc
ggtgacggcctcaagaccctggacgcggtggccgggaccgggctgaccgcgaccattcgt
cccagcctggactccttccgggaagccggcctcgcgtga

DBGET integrated database retrieval system