KEGG   Streptomyces avermitilis: SAVERM_2945Help
Entry
SAVERM_2945       CDS       T00126                                 

Gene name
ku1
Definition
(GenBank) putative Ku70/Ku80 protein
  KO
K10979  DNA end-binding protein Ku
Organism
sma  Streptomyces avermitilis
Pathway
sma03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    SAVERM_2945 (ku1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sma03400]
    SAVERM_2945 (ku1)
DNA repair and recombination proteins [BR:sma03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     SAVERM_2945 (ku1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ku HC2
Motif
Other DBs
NCBI-ProteinID: BAC70656
NITE: SAV2945
UniProt: Q82J37
Position
complement(3693749..3694849)
Genome map
AA seq 366 aa AA seqDB search
MLHVRSIWNGAISFGLVSIPIKLVNATESHSISFRQIHLEDGGRIRYRKFCELEDREVTQ
DEIGKGYEDADGTIIPITDEDLAQLPIPTARTIEIVAFVPADRIDPLQMDTPYYLSANGV
PAAKPYTLLREALKRSQKVAVAKFALRGRERLGMLRVVEDVIAMHGLLWPDEIRPPESVA
PDASVTVRDKELDLADALMDTLGEVDLNELHDGYREAVEALIEAKASGEKVPSAPADEPG
GKVLDLMAALEKSVRAAKESRGEGTGSETGSETRDRTGAKKGKATGKDTGKEAQAEVTRL
RRKTARAAPKEVGGKKSTSTAKKATAKKAAPKKTTAKKTTAKATSAKKTTAKKTPAKKAT
PRKRSA
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
gtgctgcacgtgcgatccatatggaacggcgccatctcgttcggcctggtcagtatcccg
atcaagctggtgaacgccacggagagccactccatctcgttccgccagatccatctggag
gacggcggccggatccgctaccgcaagttctgcgagctggaggaccgtgaggtcacgcag
gacgagatcggcaaggggtacgaggacgcggacggcacgatcattccgatcaccgacgag
gatctggcccagctgcccatcccgaccgcccgcaccatcgagatcgtggccttcgtcccg
gcggaccggatcgacccgctccagatggacacgccgtactacctgtcggcgaacggcgtc
cccgccgccaagccgtacacgctgctgcgcgaggccctcaagcgcagccagaaggtcgcc
gtcgcgaagttcgcgctgcgggggagggagcggctcggcatgctgcgggtcgtcgaggac
gtcatcgcgatgcacgggctgctgtggccggacgagatccggccccccgagagcgtcgcc
cccgacgcgagcgtcaccgtccgggacaaggaactggacctcgcggacgcgctgatggac
acgctcggcgaggtcgacctgaacgagctccacgacggctaccgcgaggcggtcgaggca
ctcatcgaggcgaaggcctccggcgagaaggtcccgtccgcgcctgccgatgagccgggc
ggcaaggtgctggacctgatggccgccctggagaagagcgtccgcgcggcgaaggagtcg
cgaggcgaggggacgggctcggagacgggctcggagacgcgcgaccgcacgggcgcgaag
aaggggaaggcgacggggaaggacacggggaaggaggcgcaggcggaggtgacgcggctg
cgccgcaagacggcccgcgccgcgcccaaggaggtcgggggcaagaagtcgacgtccacg
gcgaagaaggcgacggcgaagaaggcggctccgaagaagacgacggcgaagaagaccacc
gccaaggcgacgagcgcgaagaagaccacggcgaagaagaccccggccaagaaggcgacg
ccacggaaacgctctgcgtga

DBGET integrated database retrieval system