KEGG   Streptomyces avermitilis: SAVERM_2990
Entry
SAVERM_2990       CDS       T00126                                 

Gene name
gap1
Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase (insensitive to pentalenolactone)
  KO
K00134  glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
sma  Streptomyces avermitilis
Pathway
sma00010  Glycolysis / Gluconeogenesis
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
sma01230  Biosynthesis of amino acids
Module
sma_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sma_M00002  Glycolysis, core module involving three-carbon compounds
sma_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAVERM_2990 (gap1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sma04131]
    SAVERM_2990 (gap1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sma04147]
    SAVERM_2990 (gap1)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.12  glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)
     SAVERM_2990 (gap1)
Membrane trafficking [BR:sma04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SAVERM_2990 (gap1)
Exosome [BR:sma04147]
 Exosomal proteins
  Proteins found in most exosomes
   SAVERM_2990 (gap1)
SSDB
Motif
Pfam: Gp_dh_C Gp_dh_N 2-Hacid_dh_C
Other DBs
NCBI-ProteinID: BAC70701
NITE: SAV2990
UniProt: Q82IZ2
Position
3745497..3746501
AA seq 334 aa
MTVRVGINGFGRIGRNVFRAAATRGADLEIVAVNDLGDVATMAHLLAYDSILGRFPEEVT
AEPGAIRAGDTTVKVLAERDPAALPWGDLGVDVVIESTGIFTDAAKARAHVDGGAKKVII
AAPASNEDVTVVLGVNQDAYDPERHTIISNASCTTNCLGVLAKVLHDAVGIESGMMTTVH
AYTQDQNLQDAPHKDLRRARAAGLNIVPTSSGAAKAIGLVLPELQGRLDAFALRVPVPTG
SVTDLTVTASRSTTVEEVKEAYAKAAAGAYKGLLSYTEAPIVSTDIAGDPASCVFDAELT
RVLGSQVKVVGWYDNEWGYSNRLIDLALLVGDTL
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgactgttcgtgtcggcatcaatggcttcgggcggatcggacgcaacgtcttccgcgcg
gcagccacccggggcgcggatctggagatcgtcgccgtcaacgatctcggcgacgtggcg
accatggcccatctgctggcctacgactcgatcctgggccgcttcccggaggaggtcacc
gcggaacccggtgcgatccgcgccggcgacaccaccgtcaaggttctcgccgagcgcgac
cccgccgccctgccctggggcgacctgggcgtggacgtggtcatcgagtccaccggcatc
ttcacggacgcggccaaggcccgcgcgcacgtggacggcggcgccaagaaggtcatcatc
gcggccccggccagcaacgaggacgtcacggtcgtgctcggcgtgaaccaggacgcctac
gacccggagcgccacacgatcatctccaacgcctcgtgcaccaccaactgcctcggcgta
ctggccaaggtgctgcacgacgccgtgggcatcgagtccggcatgatgaccacggtccac
gcctacacccaggaccagaacctccaggacgccccgcacaaggacctgcgccgtgcccgg
gccgcgggcctcaacatcgtgcccacctccagcggagccgccaaggccatcggcctggtg
ctgcccgaactccagggccgcctcgacgccttcgccctgcgggtccccgtccccaccggc
tcggtcaccgacctgacggtcaccgccagccgcagcaccacggtggaagaggtcaaggag
gcgtacgccaaggccgccgccggcgcgtacaagggtctgttgtcctacaccgaggccccc
atcgtcagcaccgacatcgcgggggaccccgcctcctgcgtcttcgacgccgagctgacc
cgcgtactgggctcccaggtcaaggtcgtcggctggtacgacaacgagtggggctactcc
aaccgcctcatcgacctggccctgctggtcggcgacaccctctga

KEGG   Streptomyces avermitilis: SAVERM_6296
Entry
SAVERM_6296       CDS       T00126                                 

Gene name
gap2
Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase (sensitive to pentalenolactone)
  KO
K00134  glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
sma  Streptomyces avermitilis
Pathway
sma00010  Glycolysis / Gluconeogenesis
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
sma01230  Biosynthesis of amino acids
Module
sma_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sma_M00002  Glycolysis, core module involving three-carbon compounds
sma_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAVERM_6296 (gap2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sma04131]
    SAVERM_6296 (gap2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sma04147]
    SAVERM_6296 (gap2)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.12  glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)
     SAVERM_6296 (gap2)
Membrane trafficking [BR:sma04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SAVERM_6296 (gap2)
Exosome [BR:sma04147]
 Exosomal proteins
  Proteins found in most exosomes
   SAVERM_6296 (gap2)
SSDB
Motif
Pfam: Gp_dh_C Gp_dh_N 2-Hacid_dh_C GFO_IDH_MocA NAD_binding_7
Other DBs
NCBI-ProteinID: BAC74007
NITE: SAV6296
UniProt: Q829W3
Position
7559711..7560718
AA seq 335 aa
MTIRVGINGFGRIGRNYFRALLEQGADIEIVAVNDLGDTATTAHLLKYDTILGRLKAEVT
HTADTITVDGKTIKVFSERNPADIPWGELNVDIVIESTGIFTKKADAEKHIAGGAKKVLI
SAPASDEDITIVLGVNEDKYDPAKHNVISNASCTTNCVAPMAKVLDENFGIVKGLMTTIH
AYTNDQRILDFPHKDLRRARAAAENIIPTTTGAAKATALVLPQLKGKMDGISMRVPVPTG
SATDLVVEVSREVTKDEVNAAFKKAAEGELQGYLSYTEDPIVSSDIVGDPSSCTFDSAMT
MVMEGTSVKILGWYDNEWGYSNRLVDLTVFVGNQL
NT seq 1008 nt   +upstreamnt  +downstreamnt
gtgacgatccgcgtaggcatcaacggctttggccgcatcggtcgtaactacttccgcgcg
ctgctggagcagggtgcagacatcgagatcgtggctgtcaacgacctgggtgacaccgcg
accaccgctcacctgctgaagtacgacacgattctgggccgtctcaaggccgaggtgacg
cacaccgccgacacgatcaccgtggacggcaagaccatcaaggtgttctccgagcgcaac
cccgccgacatcccgtggggcgagctgaacgtcgacatcgtcatcgagtcgaccggcatc
ttcaccaagaaggccgacgccgagaagcacatcgccggcggcgccaagaaggtcctcatc
tcggctccggcctccgacgaggacatcaccatcgtcctcggcgtcaacgaggacaagtac
gacccggcgaagcacaacgtcatctcgaacgcgtcctgcaccaccaactgtgtggcgccg
atggccaaggttctcgacgagaacttcggcatcgtcaagggcctgatgaccaccatccac
gcgtacacgaacgaccagcgcatccttgacttcccgcacaaggacctgcgccgcgcccgt
gccgccgccgagaacatcatcccgaccaccacgggtgccgccaaggccaccgcgctggtc
ctcccgcagctcaagggcaagatggacggcatctccatgcgcgtcccggtccccacgggc
tcggccaccgacctggtcgtcgaggtctcccgtgaggtcaccaaggacgaggtcaacgcc
gcgttcaagaaggccgccgagggcgagctgcagggctacctgtcgtacaccgaggacccg
atcgtctcctcggacatcgtcggcgacccgtcgtcctgcaccttcgactcggccatgacc
atggtcatggagggcacctcggtgaagatcctcggctggtacgacaacgagtggggctac
tccaaccgcctcgtcgacctcacggtcttcgtcggcaaccagctctaa

DBGET integrated database retrieval system