KEGG   Streptomyces avermitilis: SAVERM_3114Help
Entry
SAVERM_3114       CDS       T00126                                 

Gene name
tatB
Definition
(GenBank) putative sec-independent protein translocase protein TatB
  KO
K03117  sec-independent protein translocase protein TatB
Organism
sma  Streptomyces avermitilis
Pathway
sma03060  Protein export
sma03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    SAVERM_3114 (tatB)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SAVERM_3114 (tatB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sma02044]
    SAVERM_3114 (tatB)
Secretion system [BR:sma02044]
 Twin-arginine translocation (Tat) system
  Twin-arginine translocation (Tat) pathway protein
   SAVERM_3114 (tatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MttA_Hcf106 DUF1823 ROS_MUCR
Motif
Other DBs
NCBI-ProteinID: BAC70825
NITE: SAV3114
UniProt: Q82IL9
Position
complement(3887259..3887705)
Genome map
AA seq 148 aa AA seqDB search
MFNDIGPLELVTLVVLAVLVFGPDKLPKMIQDVTRTIRKIREFSESAKQDIREELGPEFK
DFEFEDLNPKTFIRKQLDNDELGLKEIRNGFDLKKEMAEVTDAVHGRESETSASSSSANG
SAGGTVDMTKKREQLEADERPPFDADAT
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
gtgttcaatgacataggaccgcttgagctggtgacgctcgttgtccttgctgtgctcgtc
ttcggcccggacaagcttccgaagatgatccaggacgtcacgcgcaccatccgtaagatc
cgcgagttctcggagagcgccaagcaggacatacgggaggaactcggtccggagttcaag
gacttcgagttcgaggatctcaaccccaagacgttcatccgcaagcagctggacaacgac
gagctggggctcaaggagatccgcaacggcttcgacctgaagaaggagatggccgaggtc
acggacgcggtgcacggccgtgagtccgagacctccgcctcctcctcgtcggccaacggc
tccgccggcggcacggtcgacatgacgaagaagcgcgagcagctcgaagcggacgagcgc
ccgcccttcgacgcggacgccacctga

DBGET integrated database retrieval system