KEGG   Streptomyces avermitilis: SAVERM_3130
Entry
SAVERM_3130       CDS       T00126                                 

Definition
(GenBank) putative acetyltransferase
  KO
K22476  N-acetylglutamate synthase [EC:2.3.1.1]
Organism
sma  Streptomyces avermitilis
Pathway
sma00220  Arginine biosynthesis
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01210  2-Oxocarboxylic acid metabolism
sma01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    SAVERM_3130
Enzymes [BR:sma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     SAVERM_3130
SSDB
Motif
Pfam: Acetyltransf_1 FR47 GNAT_acetyltran Acetyltransf_10 Acetyltransf_7 Nudix_hydro Acetyltransf_9 Collagen Acetyltransf_8 Acetyltransf_3 Acetyltransf_CG Bd3614_N
Other DBs
NCBI-ProteinID: BAC70841
NITE: SAV3130
UniProt: Q82IK3
Position
3902103..3903476
AA seq 457 aa
MEISAGGQLEVRITTADVGKRVSVRRWNEDVAGGEKFTDTVGVLTSWDNGVLLITRRGGE
SVRIAESSLVAGKVVPAAPARRRGPAASYEELARIAARAWQPVERERLGDWQLRASAGFT
RRANSVLPVGEPGLPLDEALTVVRDWYAGRELPAYIQTATGAEGTQELLCAELEARGWTR
EVTAELWIGALAPLADREVSAEVVLSREADEAWLSRYQRKGLNEVALKVLGSGPSVWFAT
VPGAAGRAPAAIGRCVVDGRWAGFAAVEVDPAQRRRGLATAVMTALARRALEEGASAAWL
QVETDNAAARALYAGMGFATHHAYHHYRWASESDVRGELGGRERGAPGEAGVSGEAGVPD
EAGAPSEAGAPSESGAPSEAGAPSESSTAGESGALGGSSAPRGISTPDVSSAAGESGDEV
CGGSGAGSVGGPGSGPPGASGGGSGDAVDGVGTYRSV
NT seq 1374 nt   +upstreamnt  +downstreamnt
gtggaaatctctgcgggcggacagctcgaagtccgtatcaccactgctgacgtgggaaaa
cgcgtctccgtgcggcggtggaacgaagatgtcgcggggggtgagaagttcaccgacacg
gtcggagttctcacatcatgggacaacggagtgttgctgatcacacggcggggcggcgaa
agcgtccggatagcggagtcctcgctggtcgcgggcaaggtcgtaccggccgcaccggcg
cgtcggcggggtcccgcggcctcgtacgaggagctggcgcggatcgccgcgcgggcctgg
cagccggtggagcgcgaacggctcggcgactggcagctgcgggcgtccgccggcttcacc
cgccgggccaactccgtcctgcccgtcggcgagccgggactgccgctggacgaggcgctg
accgtcgtacgggactggtacgcgggccgtgagctgccggcgtacatccagaccgcgacc
ggggccgagggcacgcaggagctgctgtgcgcggagctggaggcgcgcggatggacgcgt
gaggtgacggccgagctgtggatcggcgcgctggcgccgctggccgaccgggaggtgtcc
gccgaggtggtgctgtcccgcgaggcggacgaggcgtggctgagccgctaccagcgcaag
gggctgaacgaggtcgcgctgaaggtgctgggcagcgggccctccgtctggttcgcgacg
gtgccgggggccgcgggccgcgctccggccgcgatcgggcggtgcgtggtggacgggcgc
tgggcgggtttcgcggcggtcgaggtggaccccgcgcagcggcgccgtgggctggccacc
gcggtgatgacggccctggcccgccgggctctggaggagggcgcctcggcggcctggctc
caggtggagacggacaacgcggcggcgcgggcgttgtacgcggggatgggattcgcgacg
catcacgcgtatcaccactatcggtgggcgtctgagagcgatgtgcggggcgagctcggg
ggccgggagcgtggtgcgccgggtgaggccggtgtgtcgggtgaggctggtgtgccagat
gaggctggtgcgcccagtgaggccggtgcgccgagtgagagtggtgcgccgagtgaggcc
ggtgcgccgagtgagagcagtacggctggtgagagcggtgcgctgggcgggagcagtgcg
cctcgcgggatcagtacgccggatgtgagcagtgcggctggtgagagcggtgacgaggtg
tgtggcggttcgggggccgggtcggtcggcgggccgggcagtggtccgcctggcgcatcg
ggcggcggctcgggcgatgctgtggacggcgtcggaacgtatcgatcggtatga

KEGG   Streptomyces avermitilis: SAVERM_4694
Entry
SAVERM_4694       CDS       T00126                                 

Definition
(GenBank) putative acetyltransferase
  KO
K00619  amino-acid N-acetyltransferase [EC:2.3.1.1]
Organism
sma  Streptomyces avermitilis
Pathway
sma00220  Arginine biosynthesis
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01210  2-Oxocarboxylic acid metabolism
sma01230  Biosynthesis of amino acids
Module
sma_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    SAVERM_4694
Enzymes [BR:sma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     SAVERM_4694
SSDB
Motif
Pfam: Acetyltransf_1 Acetyltransf_7 Acetyltransf_10 Acetyltransf_9
Other DBs
NCBI-ProteinID: BAC72406
NITE: SAV4694
UniProt: Q82EC1
Position
5719744..5720286
AA seq 180 aa
MEKPAERAPEVSAKAITVRRARTSDVPAVRRLLDSYVRRGILLDKATVTLYEDIQEFWVA
ERDDNAEVLGCGALHVMWEDLAEVRTLAVNPDAKGLGVGHQLLGKLLQTARWLGVRRVFC
LTFEVDFFGKHGFVEIGETPVDTDVYAELLRSYDEGVAEFLGLERVKPNTLGNSRMLLHL
NT seq 543 nt   +upstreamnt  +downstreamnt
gtggagaagcccgcagagcgcgcccccgaagtcagcgcaaaagccatcaccgtccggcgg
gccaggaccagcgatgtcccggcggtgcgccgcctcctcgactcgtacgtccgacgcggc
atcctgctcgacaaagcgacggtgacgctttacgaggacatccaggagttctgggtcgcg
gaacgggatgacaacgccgaggtcctcggctgcggcgcgctccatgtgatgtgggaagac
ctcgcggaagtccgcactcttgcggtgaacccggacgccaaggggctcggcgtcggtcac
cagttgctgggcaagttgctgcagaccgcccgctggctgggtgttcgccgtgttttctgt
ctgaccttcgaagtggacttcttcgggaagcacggcttcgtggagatcggagagacgccc
gttgacaccgatgtctacgccgagctgctgcgttcctatgacgagggcgtagcagagttc
ctcggtctcgaacgagtgaaaccgaacaccttgggcaacagccggatgcttctgcatctg
tga

KEGG   Streptomyces avermitilis: SAVERM_6764
Entry
SAVERM_6764       CDS       T00126                                 

Gene name
argJ
Definition
(GenBank) putative glutamate N-acetyltransferase/amino-acid N-acetyltransferase
  KO
K00620  glutamate N-acetyltransferase / amino-acid N-acetyltransferase [EC:2.3.1.35 2.3.1.1]
Organism
sma  Streptomyces avermitilis
Pathway
sma00220  Arginine biosynthesis
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01210  2-Oxocarboxylic acid metabolism
sma01230  Biosynthesis of amino acids
Module
sma_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    SAVERM_6764 (argJ)
Enzymes [BR:sma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     SAVERM_6764 (argJ)
    2.3.1.35  glutamate N-acetyltransferase
     SAVERM_6764 (argJ)
SSDB
Motif
Pfam: ArgJ DUF2188
Other DBs
NCBI-ProteinID: BAC74475
NITE: SAV6764
UniProt: Q828A5
Position
8080900..8082051
AA seq 383 aa
MSVTAAQGFTASGIAAGIKENGNPDLALVVNNGPRLAAAGVFTSNRVKAAPVLWSEQVLK
GGVVSAVVLNSGGANACTGPKGFQDTHATAEKVAETLDLNAGEVAVASTGLIGVLLPMDK
LLPGVERAVAGLSEHGGEKAAIAIKTTDTVHKTSVVTKDGWTVGGMAKGAGMLAPGLATM
LVVLTTDADLDRDALDRALRAATRTTFDRVDSDGCMSTNDTVLLLASGASEVTPKQEEFA
EAVRAVCDDLGQQLIQDAEGASKDIKVEVVGAATEDDAVEVGRSIARNNLLKCAIHGEDP
NWGRVLSAIGTTRAAFEPDQLNVAINGVWVCKKGGVGEDRDLVDMRYREVHIVADLAAGT
ETATIWTNDLTADYVHENSAYSS
NT seq 1152 nt   +upstreamnt  +downstreamnt
gtgagcgtcaccgctgcccagggcttcaccgcctccggcatcgcagcaggcatcaaggag
aacggcaatcccgacctggccctcgtggtcaacaacgggccccgtctcgccgccgcgggc
gtcttcacctccaaccgtgtgaaggccgcgccggtcctgtggtccgagcaggtgctgaag
ggcggcgtcgtctccgccgtcgtcctcaactccggtggcgccaacgcctgtacgggcccc
aagggcttccaggacacgcacgccaccgccgagaaggtcgccgagacgctggacctgaac
gccggtgaggtcgccgtcgcttccaccgggctcatcggcgtactcctgccgatggacaag
ctcctgccgggagtcgagcgggccgtcgccgggctgtccgagcacggtggcgagaaggcg
gccatcgccatcaagaccaccgacaccgtgcacaagacgtccgtcgtgacgaaggacggc
tggaccgtcggcggcatggccaagggcgccggcatgctcgcccccggcctcgccaccatg
ctcgtcgtcctcaccacggacgccgacctcgaccgcgacgcactcgaccgggccctgcgc
gccgccacccgcaccaccttcgaccgcgtcgactccgacggctgcatgtccaccaacgac
accgttctgctgctcgcctccggggcctccgaagtcaccccgaagcaggaggagttcgcg
gaggccgtccgtgcggtctgcgacgacctcggccagcagctcatccaggacgccgagggc
gccagcaaggacatcaaggtcgaggtcgtgggcgccgcgacggaggacgacgccgtcgag
gtgggccgctccatcgcccgcaacaacctcctgaagtgcgccatccacggcgaggacccc
aactggggacgcgtcctctctgcgatcggcacgacccgggccgccttcgagcccgaccag
ctgaacgtcgccatcaacggcgtctgggtctgcaagaagggcggcgtcggcgaggaccgc
gacctcgtcgacatgcgctaccgcgaggtccacatcgtcgccgacctcgccgccggcacc
gagaccgccaccatctggaccaacgacctcaccgcggactacgtccacgagaacagcgcc
tactcctcatga

DBGET integrated database retrieval system