KEGG   Streptomyces avermitilis: SAVERM_3185Help
Entry
SAVERM_3185       CDS       T00126                                 

Gene name
prpM3
Definition
(GenBank) putative magnesium or manganese-dependent protein phosphatase
Organism
sma  Streptomyces avermitilis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SpoIIE PAS_4 PAS GAF_2 PAS_8 PAS_9 GAF HATPase_c_2 GAF_3 HATPase_c
Motif
Other DBs
NCBI-ProteinID: BAC70896
NITE: SAV3185
UniProt: Q82IG2
Position
complement(3966409..3969351)
Genome map
AA seq 980 aa AA seqDB search
MCRPVQKASGPCCDREHRVVRCRSAGYCGQPPPVTGAGRGELEGTVRVSEIPAKATESED
PSDGARAKAVADSAMPTAADDAAHPRRAVAADGTADGSVDDAESGSAGEAESGSPAATAD
ALAGGRADDRSGGRADYGADEPIGTRTGEPVGDMMWQSSPPGSMYDYIKVASFSIGPDGL
VEQWSLRAEQIFGISAERAVGMDPIAAFVAPDRREFGQRKMAEILDGREWTGVVPFRMPT
PEATEGLAEVYVMPTTTEDGERAAVCIVVDVRTLRRIETDLAASQAIFGQSPFGFLLIDT
DLRVRRANQRFASTFGGKVDDHRGRSVHDYLPSPEAERVSATLRRVLETGNSITDMHVTG
FVPGSDERRDWSINLYRVHSGSGRPIGVAWLGTDNTARRAAAREAAAARRNLALLNEAGA
RIGNSLDLETTARELLDVVVPGFCDLATVDLYQGLLAGDETPPGRADGSAELRRVAFSSA
VSDAPFAGGPDPVTVGAVHHYPFNSPGADALRTGRPQHVPPEDGGLIQSTLAVPMVAHDT
VVGLAQFSRTKGSEPFGERDRALAVELAARAAVCIDNARLYRREHERALILQRSLLPPGD
PEASGLDIACRYLPGNAATEVGGDWFDVIELPGHRTALVVGDVMGRGLRAAVAMGELRTA
VRTLALLDLEPAEVLSALDEIARGLGTPGGVQQATRTARQPRDADLSEVYLATCVYAVYD
SVTRRCTFANAGHLPPVLVEPGETALMLDVPPGMPLGVGGEPFEEVEVELPEGALLALYT
DGLVESRDHPLDEGLQAFVGALTDPTSPLEDVCDHVLNTLDTHHGEDDIALLMARVQGLP
AESVGDWTLPREPRSVGRAREYARGQLVSWGLEPLVDTAELLVSELVTNALRYGEGEIRL
RLLLDRTLVCEVWDAGLVQPRRRRARDTDEGGRGLQLVGLLSAGWGSRRTPRGKTVWFEL
PLPDGETGLTDPAEALLSLF
NT seq 2943 nt NT seq  +upstreamnt  +downstreamnt
atgtgccggccggtccaaaaagcatcgggaccgtgctgtgatcgtgaacaccgtgttgtg
cggtgccgtagtgctggatactgcgggcagccgcccccggtgaccggtgccggacgcggt
gagctggaggggacggttcgcgtgagcgagataccagcgaaggccacggagtccgaggac
ccgtcggacggcgcgagggcaaaggccgtggctgactcggccatgcccaccgcggccgac
gacgcggcccacccccgcagagccgtcgcggcggacggtacggcggacggctccgtggac
gacgctgagagcggctccgcgggtgaggccgagagcggctccccggctgccacggccgat
gccctggccggcggccgggccgatgaccggtccggcggccgggctgattacggggctgat
gaaccgatcggtacccggaccggtgagccggtcggcgacatgatgtggcagagcagtccg
cccgggtccatgtacgactacatcaaggtcgcctccttctccatcggcccggacgggctc
gtcgagcagtggagtctgcgcgccgagcagatcttcggtatttccgcggagcgcgcggtc
ggcatggaccccatcgcggcgttcgtcgcgcccgaccggcgtgagttcggacagcgcaag
atggcggagatactcgacggacgcgagtggaccggcgtggtccccttccggatgcccact
ccggaagcgaccgaagggctcgccgaggtctatgtgatgcccaccacgaccgaggacggc
gaacgagccgccgtctgcatcgtcgtggacgtccgcaccctgcgccggatcgagaccgac
cttgccgcctcgcaggcgatattcggtcaatctccgttcggattcctgctgatcgacacc
gatctgcgggtacgccgcgccaaccagcgcttcgcctccacgttcggcggcaaggtggac
gaccaccgtgggcgctccgtccacgactacctgccgtccccggaggccgagcgcgtcagc
gcgaccctgcgccgcgtcctggagaccggcaactcgatcacggacatgcacgtcacgggc
ttcgtccccggctccgacgagcgccgcgactggtccatcaacctctaccgcgtgcacagc
ggcagcggccgccccatcggtgtcgcctggctcggaaccgacaacaccgcccgccgtgcg
gccgcccgcgaggccgcggccgcccgacgcaatctcgcccttctgaacgaggccggcgcc
cgcataggcaactccctcgacctggagaccacggcacgcgaacttctcgacgtcgtcgtc
cccggcttctgcgacctcgccaccgtcgacctgtaccaagggctgctggccggcgacgag
accccgccgggccgggccgacggcagtgccgagctgcgccgggtcgccttctccagcgcg
gtctccgacgcccctttcgccggtggacccgacccggtgacggtcggcgcggtgcaccac
taccccttcaactcgcccggcgccgacgccctgcgcaccggccgcccgcagcacgtcccg
cccgaggacggcggcctcatccagtccacgctcgccgtcccgatggtcgcgcacgacacg
gtggtcggcctcgcccagttctcccgtacgaagggcagcgagccgttcggcgaacgcgac
cgcgcactcgccgtggagctggccgcgcgtgccgcggtctgtatagacaacgcgcgcctg
taccgccgggagcacgagcgcgcgttgatactccagcgctcgctccttcccccgggcgac
ccggaggcgtcgggtctggacatcgcgtgccggtatctgccgggcaacgcggcgacggag
gtcggcggcgactggttcgacgtcatcgaactccccggccaccgcaccgcgctggtcgtc
ggcgacgtgatgggccgcggtctgcgtgccgccgtcgccatgggcgaactccgcacggcc
gtacgcacgctggcgctgctcgacctcgaacccgccgaagtcctctcggcgctggacgag
atcgcccggggcctcggcacccccggcggtgtccagcaggccacccgcacggcccgccag
ccgcgcgacgcggacctgtccgaggtgtacctcgcgacctgtgtgtacgcggtctacgac
tcggtgacgcgacggtgcaccttcgccaacgccggccacctgccgcccgtcctcgtcgag
ccgggcgagaccgcgctgatgctcgacgtaccgccgggcatgccgctgggcgtgggcggc
gagccgttcgaggaggtggaggtggagctgccggaaggggctctgctggcgctctacacg
gacggcctggtcgaatcccgcgaccaccccctcgatgaggggctgcaagcgttcgtgggc
gcgctcaccgaccccaccagcccgctggaggacgtgtgcgaccacgttctcaacaccctc
gacacacaccacggcgaggacgacatcgcgttgctgatggcgcgtgtgcaggggctgccg
gccgagtccgtcggcgactggacgctgccgcgggagccgcgcagtgtggggcgggcgcgg
gagtacgcgcgcggacaactggtcagctggggtctggagccgctggtggacacggcggag
ctcctggtcagcgagttggtgaccaatgcgctgcgctacggcgagggcgagatcagactc
cgtctgctcctcgaccgcacgctggtgtgcgaggtctgggacgcgggtctggtgcagccg
cgccggcgccgggcgcgggacaccgacgagggcgggcgcggcctgcaactcgtcgggctg
ctctcggccgggtggggctcacggcggacgccgcgcggcaagacggtgtggttcgaactc
ccgctcccggacggcgaaacgggcctgacggatccggcggaggcgctgctcagcctgttc
tag

DBGET integrated database retrieval system