KEGG   Streptomyces avermitilis: SAVERM_3209
Entry
SAVERM_3209       CDS       T00126                                 

Gene name
ppgK
Definition
(GenBank) putative polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
sma  Streptomyces avermitilis
Pathway
sma00010  Glycolysis / Gluconeogenesis
sma00520  Amino sugar and nucleotide sugar metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
Module
sma_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sma_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAVERM_3209 (ppgK)
   00520 Amino sugar and nucleotide sugar metabolism
    SAVERM_3209 (ppgK)
Enzymes [BR:sma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     SAVERM_3209 (ppgK)
SSDB
Motif
Pfam: ROK
Other DBs
NCBI-ProteinID: BAC70920
NITE: SAV3209
UniProt: Q82IE9
Position
complement(4000786..4001532)
AA seq 248 aa
MQIFGVDIGGSGTKGAPVDLDRGELTEERFKVLTPHPATPDAVADGVKEVVGHFGWTGPV
GITFPGVVTGGATIRTAANVDKSWIDTDARALLSDRLGGRPVTVLNDADAAGVAEMQFGA
GRDRQGTVLVLTFGTGIGSALFVDGALVPNTELGHLELHGHDAEKRASTKVKEDNDMSWE
HWAHRVQKYLAHVEMLFSPELFIIGGGVSRKSHKFLPLIEGIKAEIVPAALQNNAGIVGA
AMTAAKSA
NT seq 747 nt   +upstreamnt  +downstreamnt
atgcagatcttcggtgtggacatcggtggatccgggaccaagggcgctcccgtggacctg
gacaggggcgagctgacggaggagcgcttcaaggtgctgactccgcacccggcgacgccg
gacgcggtggccgacggcgtgaaggaggtcgtcggccacttcggctggacgggcccggtc
gggatcacgttcccgggagtggtcaccggcggtgccacgatccgtacggcggccaatgtg
gacaagagctggatcgacacggacgcgcgcgccctgctgagcgaccggctgggcgggcgc
ccggtgacggtgctgaacgacgcggacgcggcgggtgtggccgagatgcagttcggcgcg
gggcgcgaccgccagggcacggtcctcgtcctcacgttcggcacggggatcggcagcgcc
ctgttcgtcgacggcgccctcgtcccgaacacggagctgggccacctcgagctgcacggc
cacgacgcggagaagcgtgcctcgacgaaggtcaaagaggacaacgacatgtcgtgggag
cactgggcgcaccgcgtccagaagtacctcgcgcacgtggagatgctcttctctccggag
ctgttcatcatcggcggcggagtcagccgcaagtcgcacaagttcctgcccctgatcgag
ggaatcaaggcggagatcgtcccggcggcgcttcagaacaacgcggggatcgtgggcgcg
gcgatgacggcggcgaagagcgcgtag

DBGET integrated database retrieval system