KEGG   Streptomyces avermitilis: SAVERM_3287
Entry
SAVERM_3287       CDS       T00126                                 

Gene name
pckA
Definition
(GenBank) putative phosphoenolpyruvate carboxykinase
  KO
K01596  phosphoenolpyruvate carboxykinase (GTP) [EC:4.1.1.32]
Organism
sma  Streptomyces avermitilis
Pathway
sma00010  Glycolysis / Gluconeogenesis
sma00020  Citrate cycle (TCA cycle)
sma00620  Pyruvate metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
Module
sma_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAVERM_3287 (pckA)
   00020 Citrate cycle (TCA cycle)
    SAVERM_3287 (pckA)
   00620 Pyruvate metabolism
    SAVERM_3287 (pckA)
Enzymes [BR:sma01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.32  phosphoenolpyruvate carboxykinase (GTP)
     SAVERM_3287 (pckA)
SSDB
Motif
Pfam: PEPCK_GTP PEPCK_N
Other DBs
NCBI-ProteinID: BAC70998
NITE: SAV3287
UniProt: Q82I71
Position
complement(4089495..4091318)
AA seq 607 aa
MARDIAAPSSVPTQHKELISWVNEIAELTQPDSVVWCDGSEAEYERLSEELVRKGTFRKL
DPIKRPNSYYAASDPTDVARVEDRTFICSEKEEDAGPTNHWKDPAEMREIFAGEQGVFRG
SMRGRTMYVVPFCMGPLGSDLSAIGVEITDSAYVAVSMRTMTRMGQPVLDELGTDGFFVR
AVHTLGAPLEAGEADVPWPCNSTKYISHFPESREIWSYGSGYGGNALLGKKCYALRIASV
MARDEGWLAEHMLILKLTPPQGESKYVAAAFPSACGKTNLAMLEPTVGGWTVETIGDDIA
WMRFGEDGRLYAINPEAGFFGVAPGTGEHTNANAMKTLWGNSVFTNVALTDDNDIWWEGM
TEETPAHLTDWKGNDWTPESGTPAAHPNARFTVPASQCPIIAPEWEDPKGVPISAILFGG
RRATAVPLVTESFDWNHGVFLGANVASEKTAAAEGKVGELRRDPFAMLPFCGYNMGDYMG
HWVDVAKDKDQAKLPKIYYVNWFRKNDEGKFVWPGFGENSRVLKWIVERLEGRAEGVETP
IGILPTREALDTAGLDLSASDLDFLLTVDKEVWREEAALVPEHLNTFGEHTPKELWDEYR
ALVQRLG
NT seq 1824 nt   +upstreamnt  +downstreamnt
gtggcgcgcgacatcgcggctccctccagcgtccccacccagcacaaagaactgatctcg
tgggtcaacgagatcgccgaactgacgcagccggacagtgtggtctggtgtgacggatcc
gaggcggaatacgagcgactgagcgaggagctcgtccgcaagggcaccttcaggaagctc
gacccgatcaagcgccccaactcgtactacgccgcctccgacccgaccgatgtcgcgcgg
gtcgaggaccggacgttcatctgctccgagaaggaagaggacgcgggcccgaccaaccac
tggaaggaccccgccgagatgcgggagatcttcgccggtgagcagggcgtcttccgcggc
tcgatgaggggccggacgatgtacgtcgtcccgttctgcatgggcccgctcggctcggac
ctctccgcgatcggcgtggagatcaccgactccgcgtacgtcgccgtgtccatgcgcacc
atgacccgcatggggcagccggtcctggacgagctcggcaccgacggcttcttcgtgcgt
gccgtgcacacgctcggagcgccgctggaggcgggcgaggcggacgtgccgtggccgtgc
aactccacgaagtacatctcgcacttccccgagtcccgcgagatctggtcgtacggctcg
ggctacggcggcaacgcgctgctcggcaagaagtgctacgccctgcgcatcgcctccgtc
atggcgcgcgacgagggctggctggccgagcacatgctgatcctcaagctcacgccgccg
cagggcgagtccaagtacgtcgccgcggctttcccgagcgcctgcggcaagacgaacctc
gccatgctggagcccacggtcggcggctggaccgtcgagacgatcggtgacgacatcgcg
tggatgcggttcggcgaggacggccggctgtacgcgatcaaccccgaggccggtttcttc
ggcgtcgcgcccggcaccggcgagcacaccaacgccaacgcgatgaagaccctgtggggc
aactccgtcttcaccaacgtcgcgctcaccgacgacaacgacatctggtgggagggcatg
acggaggagactccggcccacctcaccgactggaagggcaacgactggacgccggagtcc
ggtacgcccgccgcgcaccccaacgcccgcttcaccgtccccgcctcgcagtgcccgatc
atcgcgcccgagtgggaggaccccaagggcgtgccgatatcggcgatcctcttcggtggc
cgccgcgccaccgcggtcccgctggtgacggagtccttcgactggaaccacggcgtcttc
ctcggcgcgaacgtcgcctccgagaagaccgccgccgccgagggcaaggtcggtgagctg
cgccgcgacccgttcgccatgctgccgttctgcggctacaacatgggcgactacatgggc
cactgggtcgacgtcgccaaggacaaggaccaggcgaagctccccaagatctactacgtc
aactggttccgcaagaacgacgagggcaagttcgtgtggcccggcttcggcgagaacagc
cgcgtgctgaagtggatcgtcgagcgtctcgagggcagggccgagggcgtcgagaccccc
atcggcatcctgccgaccagggaggccctggacacggccggcctcgacctgtccgcgtcc
gacctggacttcctgctcaccgtcgacaaggaggtgtggcgcgaggaggccgcgctcgtg
cccgagcacctcaacaccttcggcgagcacacaccgaaggagctgtgggacgagtaccgc
gcactggtgcagcgcctgggctga

DBGET integrated database retrieval system