KEGG   Streptomyces avermitilis: SAVERM_3302
Entry
SAVERM_3302       CDS       T00126                                 

Gene name
ilvA
Definition
(GenBank) threonine dehydratase
  KO
K01754  threonine dehydratase [EC:4.3.1.19]
Organism
sma  Streptomyces avermitilis
Pathway
sma00260  Glycine, serine and threonine metabolism
sma00290  Valine, leucine and isoleucine biosynthesis
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01200  Carbon metabolism
sma01230  Biosynthesis of amino acids
Module
sma_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAVERM_3302 (ilvA)
   00290 Valine, leucine and isoleucine biosynthesis
    SAVERM_3302 (ilvA)
Enzymes [BR:sma01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.19  threonine ammonia-lyase
     SAVERM_3302 (ilvA)
SSDB
Motif
Pfam: PALP ACT ACT_6 ACT_4
Other DBs
NCBI-ProteinID: BAC71013
NITE: SAV3302
UniProt: Q82I56
Position
complement(4110484..4111713)
AA seq 409 aa
MSYSTADSLPAVTLDDVRGAQKMLAGVARMTGMEGSRHLSQLVGAPVHFKCENLQRTGSF
KLRGAYVRIAGLLPEERAAGVVAASAGNHAQGVALASSLLGVRSTVFMPKAAPLPKISAT
REYGAEVRLHGTVVDETLAAAQEYAAETGAVFIHPFDHPDIIAGQGTVGLEILEQCPEVR
TIVVGIGGGGLAAGIATAVKALRPDVRIVGVQAAGAAAYPPSLAAGRPVSVENPATMADG
IKVGRPGDVPFRIIGDLVDEVRTVSEGNLSSALLLCLERAKLVVEPAGASPVAALLREPG
AFEGPVVAVLSGGNVDPLLMQRILRHGMAAAGRYLAVRLRLTDRPGALATLLGVLPTVDA
NVLDVSHVRTDPRLGLTEVEVELHLETKGPEHCAEVEQALREAGYTVID
NT seq 1230 nt   +upstreamnt  +downstreamnt
atgagctacagcacagctgactccttgcccgcggtgacgctcgacgacgtacggggcgcc
cagaagatgctggcgggcgtggcgcgcatgaccggcatggagggcagcaggcatctgtcc
cagctggtgggcgcgccggtgcacttcaagtgcgagaacctccagcggacgggttcgttc
aagctgcgcggtgcgtacgtgcgaatcgcgggactgctgcccgaggagcgcgccgccggg
gtcgtcgccgcgagcgccgggaaccacgcacagggtgtcgccctggcgtcgtcgctgctc
ggcgtgcgctcgacggtgttcatgccgaaggcggccccgctgcccaagatcagcgcgacc
cgggagtacggcgccgaggtgcggctgcacggaacggtggtcgacgagacgctggccgcc
gcgcaggagtacgcggccgagacgggcgcggtgttcatccaccccttcgaccatcccgac
atcatcgcaggtcagggcacggtcggcctggagatcctggagcagtgccccgaggtgcgc
acgatcgtcgtcgggatcggcggcggcgggctggccgcgggcatcgcgacagccgtgaag
gcgctgcgccccgatgtgcggatcgtgggcgtgcaggcggcgggcgcggccgcgtacccg
ccctcgctggcggccgggcgcccggtgtccgtcgagaacccggcgacgatggccgacggc
atcaaggtcggccggcccggcgacgtaccgttccggatcatcggcgatctggtcgacgag
gtgcggacggtgtccgagggcaacctgtccagcgcgctgctgctctgcctggagcgggcc
aagctggtcgtcgagccggccggcgcgagcccggtggcggcgctgctgcgggagccgggc
gccttcgaggggccggtcgtcgcggtgctgtcgggcggcaatgtggaccccctgctgatg
cagcggatcctgcggcacggcatggccgccgcgggccgctacctggccgtccggctgcgg
cttacggaccgcccgggcgccctcgcgacgctgctcggggtgctgccgacggtcgacgcc
aacgtcctcgacgtgagtcatgtacggaccgacccgcggctcgggctcacggaggtggag
gtggagctgcacctggagaccaaggggccggaacactgcgccgaggtggagcaggcgctg
cgcgaggcgggctacacggtcatcgactga

DBGET integrated database retrieval system