KEGG   Streptomyces avermitilis: SAVERM_3314
Entry
SAVERM_3314       CDS       T00126                                 

Gene name
adhA4
Definition
(GenBank) putative NADP-dependent alcohol dehydrogenase
  KO
K13979  alcohol dehydrogenase (NADP+) [EC:1.1.1.2]
Organism
sma  Streptomyces avermitilis
Pathway
sma00010  Glycolysis / Gluconeogenesis
sma00561  Glycerolipid metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAVERM_3314 (adhA4)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    SAVERM_3314 (adhA4)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.2  alcohol dehydrogenase (NADP+)
     SAVERM_3314 (adhA4)
SSDB
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C 2-Hacid_dh_C ADH_zinc_N_2 NAD_binding_7
Other DBs
NCBI-ProteinID: BAC71025
NITE: SAV3314
UniProt: Q82I44
Position
complement(4125234..4126277)
AA seq 347 aa
MTTTVAAYAAPAAKAPLERTTIERREVGEFDVLIDIKFAGICHSDIHQARDGWGEGIFPM
VPGHEIAGIVAEVGSGVTKFQVGDRVGVGCMVDSCRECENCKAGLEQYCVGGNVGTYNAL
DKNGEPTYGGYSEKVVVDENYTVRIPDGLALDVAAPLLCAGITTYSPLKHWNAGPGKKVA
VLGMGGLGHMGVKIAHALGAEVTVLSQSLRKKDDGLKLGADHYYATSDPKTFEELAGTFD
IILSTVSAPLDFGAFLSLLRTDGALVNVGAPEEPISINLFSVIAGRKTLAGSGIGGIQET
QEMLDFCAEHGLGAEIELISASEINDAYERVLNSDVRYRFVIDTATI
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgaccaccactgttgccgcgtacgccgccccggccgccaaggctcccctggagcgcacc
accatcgagcggcgtgaggtcggcgagttcgacgtcctgatcgacatcaagttcgccggt
atctgccactcggacatccaccaggcccgcgacggctggggcgagggcatattcccgatg
gttccgggccacgagatcgccggcatcgtcgccgaggtcggctccggcgtcaccaagttc
caggtcggcgaccgggtgggcgtcggctgcatggtcgactcctgccgcgagtgcgagaac
tgcaaggcgggcctggagcagtactgcgtcgggggcaacgtcggcacgtacaacgccctc
gacaagaacggtgagcccacctacggcggctactccgagaaggtcgtcgtcgacgagaac
tacaccgtccgcatcccggacggcctcgccctcgacgtggccgccccgctgctctgcgcc
ggcatcaccacgtactccccgctcaagcactggaacgcgggccccggcaagaaggtcgcc
gtgctcggcatgggcggcctcggccacatgggcgtcaagatcgcgcacgcgctcggcgcc
gaggtgaccgtgctgtcccagtcgctgcgcaagaaggacgacgggctgaagctgggcgcc
gaccactactacgccaccagcgacccgaagaccttcgaggagctggcgggcacgttcgac
atcatcctgtcgacggtctcggcgccgctggacttcggcgcgttcctgtcgctgctgagg
acggacggcgccctggtgaacgtcggcgcccccgaggagccgatctccatcaacctcttc
tcggtgatcgccggccgcaagaccctcgcgggctccggcatcggcggcatccaggagacc
caggagatgctggacttctgcgccgagcacggcctcggtgcggagatcgagctgatcagc
gcgtccgagatcaacgacgcgtacgagcgggtgctgaacagcgacgtgcggtaccgcttc
gtgatcgacaccgcgacgatctga

DBGET integrated database retrieval system