KEGG   Streptomyces avermitilis: SAVERM_3362Help
Entry
SAVERM_3362       CDS       T00126                                 

Gene name
dnaN2
Definition
(GenBank) putative DNA polymerase III beta subunit
  KO
K02338  DNA polymerase III subunit beta [EC:2.7.7.7]
Organism
sma  Streptomyces avermitilis
Pathway
sma03030  DNA replication
sma03430  Mismatch repair
sma03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SAVERM_3362 (dnaN2)
   03430 Mismatch repair
    SAVERM_3362 (dnaN2)
   03440 Homologous recombination
    SAVERM_3362 (dnaN2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sma03032]
    SAVERM_3362 (dnaN2)
   03400 DNA repair and recombination proteins [BR:sma03400]
    SAVERM_3362 (dnaN2)
Enzymes [BR:sma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     SAVERM_3362 (dnaN2)
DNA replication proteins [BR:sma03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     SAVERM_3362 (dnaN2)
DNA repair and recombination proteins [BR:sma03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     SAVERM_3362 (dnaN2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_beta DNA_pol3_beta_2 DNA_pol3_beta_3
Motif
Other DBs
NCBI-ProteinID: BAC71073
NITE: SAV3362
UniProt: Q82HZ6
Position
4177745..4178875
Genome map
AA seq 376 aa AA seqDB search
MEFQVERGAFAEAVGWAARALPARSPVPVLGGLLLTADAGRLSVSGFDFEAAARIGTDAE
TVAEGQVLVLGRRLLDICRVLPDGPVSCVLEGTRFTVEAGGTRFGLSTLPREEYPALPVP
PEPYGSVDADAFASAVSQVAVAAGRDDTLPVLTGVQLRLDGDAMTLAASDRYRYAVRTLG
WQPEAAADGVVEALLPARRLLDIARSLARSGDVRIGFDRAAGGLIGFEGGRMRTVVRLLE
GRLPKYGSLFAVAGAAVAEVECGALAEAVRRVAVVAEANSPVRLDFSAPDGTVLLGAGYG
DDVAAQRLPAVLSGAEEVTAAFNPGYLLDALNSFEAPRVRLELLGAGQRTLLTAVADGGE
PDTAHRHLLMSVRQLV
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggagttccaggtcgaacgcggggcgttcgccgaggcggtgggctgggcggcccgcgca
ctgcccgcgcgttcgccggtgccggtactgggcgggctgctgctgacggcggacgcgggg
cggctgagcgtctcggggttcgacttcgaggcggccgcgcgcatcgggaccgacgcggag
acagtggcggaagggcaggtgctcgtcctcgggcgcaggctgctggacatctgccgggtg
ctgccggacggtccggtgagctgtgtgctggaggggacgcggttcacggtggaggcgggc
ggcacccggttcggcctgtcgacgctgccgcgcgaggagtacccggcgctgcccgtaccg
cccgagccgtacggcagcgtggacgccgacgcgttcgcgagcgccgtctcccaggtcgcc
gtcgccgccggacgcgacgacaccctgccggtgctcaccggcgtacagctgcgcctggac
ggcgacgcgatgacgctggccgcgtcggaccgctaccgctatgccgtgcggacgctgggg
tggcagccggaggcggcggccgacggagtcgtggaggcgctgctgcccgcgcggcggctg
ctcgacatcgcgcgctcactggcccgctccggtgacgtccgcatcggcttcgaccgggcg
gccggcgggctgatcggcttcgagggcggtcggatgcgtacggtcgtacggctgctggag
gggcggctgccgaagtacgggtcgctgttcgccgtggcgggggccgcggtcgccgaggtc
gagtgcggggcgctggcggaggcggtacggcgggtcgcggtggtggcggaggcgaacagt
ccggtgcggctggacttctcggcgccggacgggacggtgctgctgggcgccgggtacggc
gacgacgtggccgcgcagcggctgcccgccgtgctgagcggtgccgaagaggtcacggcg
gcgttcaacccggggtatctgctggacgcgctgaactccttcgaggcgccccgggtgcgg
ctggagctgctgggggccggacagcggacgctgctcacggcggtggcggacggcggcgag
ccggacaccgcgcaccggcatctgctcatgtccgtgaggcaactggtctga

KEGG   Streptomyces avermitilis: SAVERM_4317Help
Entry
SAVERM_4317       CDS       T00126                                 

Gene name
dnaN1
Definition
(GenBank) putative DNA polymerase III beta subunit
  KO
K02338  DNA polymerase III subunit beta [EC:2.7.7.7]
Organism
sma  Streptomyces avermitilis
Pathway
sma03030  DNA replication
sma03430  Mismatch repair
sma03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    SAVERM_4317 (dnaN1)
   03430 Mismatch repair
    SAVERM_4317 (dnaN1)
   03440 Homologous recombination
    SAVERM_4317 (dnaN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sma03032]
    SAVERM_4317 (dnaN1)
   03400 DNA repair and recombination proteins [BR:sma03400]
    SAVERM_4317 (dnaN1)
Enzymes [BR:sma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     SAVERM_4317 (dnaN1)
DNA replication proteins [BR:sma03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     SAVERM_4317 (dnaN1)
DNA repair and recombination proteins [BR:sma03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     SAVERM_4317 (dnaN1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_beta DNA_pol3_beta_3 DNA_pol3_beta_2
Motif
Other DBs
NCBI-ProteinID: BAC72029
NITE: SAV4317
UniProt: Q82FD7
Position
5289024..5290154
Genome map
AA seq 376 aa AA seqDB search
MKIRVERDVLAEAVAWAARSLPARPPAPVLAGLLLRAEDGALSLSSFDYEVSARVSVEAE
VEEDGTVLVSGRLLADICRALPNRPVEISTDGVRATVVCGSSRFTLHTLPVEEYPALPQM
PNATGTVPGEVFASAAAQVAIAAGRDDTLPVLTGVRIEIEGDTVTLASTDRYRFAVREFL
WKPENPDASAVALVPAKTLLDTAKALTSGDSVTLALSGSGSGEGLIGFEGAGRRTTTRLL
EGDLPKYRTLFPTEFNSIAVIETAPFVEAVKRVALVAERNTPVRLSFEQGVLILEAGSSD
DAQAVERVDAQLDGDDISIAFNPTFLLDGLSAIDSPVAQLSFTTSTKPALLSGKPAVDAE
ADEAYKYLIMPVRLSG
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
gtgaagatccgggtggaacgcgacgtactcgcggaggcagtggcctgggcggctcgcagc
ctcccggcacgaccgccggcgcctgtcctcgccggcctcctgctgagggccgaggacggg
gctctcagcctctccagcttcgactacgaggtctccgcacgcgtgtcggtggaggcggag
gtcgaggaggacggcacggtcctcgtgtcgggccgtctgctcgccgacatctgtcgcgcc
ctccccaaccggccggtggagatttccacagacggtgtacgggcgacggtggtctgcggc
tcctcccgcttcaccctccacaccctgccggtggaggagtacccggcgctcccgcagatg
ccgaacgccacgggcaccgtccccggtgaggtcttcgcgtccgccgccgcccaggtggcc
atcgccgccgggcgcgacgacacgctgcccgtcctcaccggtgtgcgcatcgagatcgag
ggcgacacggtcaccctggcgtccaccgaccgctaccgcttcgcggtccgcgagttcctg
tggaagccggagaacccggatgcgtccgcggtcgccctggtgcccgccaagaccctcctg
gacaccgccaaggcgctcaccagcggcgacagcgtcaccctggcgctgtccggctcgggg
tcgggcgagggcctgatcggcttcgagggcgcggggcggcgtacgaccacgcgtctgctg
gagggtgacctcccgaagtaccgcacgctgttcccgacggagttcaactccatcgccgtc
atcgagaccgcccccttcgtggaggccgtcaagcgcgtggccctcgtcgccgagcgcaac
accccggtgcggctcagcttcgagcagggcgtgctcatcctggaggcgggctccagcgac
gacgcacaggctgtggaaagggtcgacgcgcagctggacggcgacgacatctccatcgcc
ttcaacccgaccttcctgctggacggcctgagcgccatcgactccccggtggcacagctc
tccttcacgacgtccacgaagcccgctctgctgtccggcaagccggccgtggacgccgag
gcggacgaggcctacaagtacctgatcatgccggtgcgcctcagcggctga

DBGET integrated database retrieval system